=============================================================================== About this build: this rebuild has been done as part of reproduce.debian.net where we aim to reproduce Debian binary packages distributed via ftp.debian.org, by rebuilding using the exact same packages as the original build on the buildds, as described in the relevant .buildinfo file from buildinfos.debian.net. For more information please go to https://reproduce.debian.net or join #debian-reproducible on irc.debian.org =============================================================================== Preparing download of sources for /srv/rebuilderd/tmp/rebuilderdlRVcav/inputs/libcifpp_9.0.5-1_all.buildinfo Source: libcifpp Version: 9.0.5-1 rebuilderd-worker node: ionos25-amd64 +------------------------------------------------------------------------------+ | Downloading sources Fri, 21 Nov 2025 16:33:52 +0000 | +------------------------------------------------------------------------------+ Get:1 https://deb.debian.org/debian trixie InRelease [140 kB] Get:2 https://deb.debian.org/debian-security trixie-security InRelease [43.4 kB] Get:3 https://deb.debian.org/debian trixie-updates InRelease [47.3 kB] Get:4 https://deb.debian.org/debian trixie-proposed-updates InRelease [57.5 kB] Get:5 https://deb.debian.org/debian trixie-backports InRelease [54.0 kB] Get:6 https://deb.debian.org/debian forky InRelease [148 kB] Get:7 https://deb.debian.org/debian sid InRelease [176 kB] Get:8 https://deb.debian.org/debian experimental InRelease [82.8 kB] Get:9 https://deb.debian.org/debian trixie/non-free-firmware Sources [6548 B] Get:10 https://deb.debian.org/debian trixie/main Sources [10.5 MB] Get:11 https://deb.debian.org/debian-security trixie-security/main Sources [93.1 kB] Get:12 https://deb.debian.org/debian-security trixie-security/non-free-firmware Sources [696 B] Get:13 https://deb.debian.org/debian trixie-updates/main Sources [2788 B] Get:14 https://deb.debian.org/debian trixie-proposed-updates/main Sources [29.5 kB] Get:15 https://deb.debian.org/debian trixie-backports/non-free-firmware Sources [1052 B] Get:16 https://deb.debian.org/debian trixie-backports/main Sources [93.4 kB] Get:17 https://deb.debian.org/debian forky/non-free-firmware Sources [7408 B] Get:18 https://deb.debian.org/debian forky/main Sources [10.7 MB] Get:19 https://deb.debian.org/debian sid/non-free-firmware Sources [9384 B] Get:20 https://deb.debian.org/debian sid/main Sources [11.2 MB] Get:21 https://deb.debian.org/debian experimental/main Sources [366 kB] Get:22 https://deb.debian.org/debian experimental/non-free-firmware Sources [3332 B] Fetched 33.8 MB in 32s (1057 kB/s) Reading package lists... 'https://deb.debian.org/debian/pool/main/libc/libcifpp/libcifpp_9.0.5-1.dsc' libcifpp_9.0.5-1.dsc 2388 SHA256:ae43b998142cb0889cb1f4fae88a144316be76e0b291c61f4865bac44b882010 'https://deb.debian.org/debian/pool/main/libc/libcifpp/libcifpp_9.0.5.orig.tar.gz' libcifpp_9.0.5.orig.tar.gz 2735687 SHA256:2ac6bf93a799f1139fa3c8b69348f4fe3da5e4bcb54e7d779b8c3fb8eca2f991 'https://deb.debian.org/debian/pool/main/libc/libcifpp/libcifpp_9.0.5-1.debian.tar.xz' libcifpp_9.0.5-1.debian.tar.xz 9144 SHA256:8579f6c206d415020b863378dc5796ac144952f7d6c94f8d50533714b4b63b01 2ac6bf93a799f1139fa3c8b69348f4fe3da5e4bcb54e7d779b8c3fb8eca2f991 libcifpp_9.0.5.orig.tar.gz 8579f6c206d415020b863378dc5796ac144952f7d6c94f8d50533714b4b63b01 libcifpp_9.0.5-1.debian.tar.xz ae43b998142cb0889cb1f4fae88a144316be76e0b291c61f4865bac44b882010 libcifpp_9.0.5-1.dsc +------------------------------------------------------------------------------+ | Calling debrebuild Fri, 21 Nov 2025 16:34:24 +0000 | +------------------------------------------------------------------------------+ Rebuilding libcifpp=9.0.5-1 in /srv/rebuilderd/tmp/rebuilderdlRVcav/inputs now. + nice /usr/bin/debrebuild --buildresult=/srv/rebuilderd/tmp/rebuilderdlRVcav/out --builder=sbuild+unshare --cache=/srv/rebuilderd/cache -- /srv/rebuilderd/tmp/rebuilderdlRVcav/inputs/libcifpp_9.0.5-1_all.buildinfo /srv/rebuilderd/tmp/rebuilderdlRVcav/inputs/libcifpp_9.0.5-1_all.buildinfo contains a GPG signature which has NOT been validated Using defined Build-Path: /build/reproducible-path/libcifpp-9.0.5 I: verifying dsc... successful! Get:1 http://deb.debian.org/debian unstable InRelease [176 kB] Get:2 http://snapshot.debian.org/archive/debian/20251120T202450Z forky InRelease [148 kB] Get:3 http://deb.debian.org/debian unstable/main amd64 Packages [10.2 MB] Get:4 http://snapshot.debian.org/archive/debian/20251120T202450Z forky/main amd64 Packages [9664 kB] Fetched 20.2 MB in 2s (9521 kB/s) Reading package lists... W: http://snapshot.debian.org/archive/debian/20251120T202450Z/dists/forky/InRelease: Loading /etc/apt/trusted.gpg from deprecated option Dir::Etc::Trusted Get:1 http://deb.debian.org/debian unstable/main amd64 dash amd64 0.5.12-12 [98.5 kB] Fetched 98.5 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmppbd201yz/dash_0.5.12-12_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libjs-sphinxdoc all 8.2.3-9 [27.7 kB] Fetched 27.7 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp2z58url3/libjs-sphinxdoc_8.2.3-9_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpam-runtime all 1.7.0-5 [249 kB] Fetched 249 kB in 0s (24.1 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpayu5z0fq/libpam-runtime_1.7.0-5_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 xz-utils amd64 5.8.1-2 [660 kB] Fetched 660 kB in 0s (55.3 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpinqzse7u/xz-utils_5.8.1-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libarchive13t64 amd64 3.7.4-4+b1 [349 kB] Fetched 349 kB in 0s (28.0 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp736hm4d2/libarchive13t64_3.7.4-4+b1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 g++-15-x86-64-linux-gnu amd64 15.2.0-8 [13.2 MB] Fetched 13.2 MB in 0s (172 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpf0mqvz03/g++-15-x86-64-linux-gnu_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libz3-4 amd64 4.13.3-1 [8560 kB] Fetched 8560 kB in 0s (154 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp3gs6wk05/libz3-4_4.13.3-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 binutils amd64 2.45-8 [267 kB] Fetched 267 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpgy74hniz/binutils_2.45-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libmpfr6 amd64 4.2.2-2 [742 kB] Fetched 742 kB in 0s (55.8 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpg0vrncem/libmpfr6_4.2.2-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libtool all 2.5.4-7 [540 kB] Fetched 540 kB in 0s (47.3 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpnbah39gw/libtool_2.5.4-7_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 po-debconf all 1.0.21+nmu1 [248 kB] Fetched 248 kB in 0s (24.1 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp7qtqlc6a/po-debconf_1.0.21+nmu1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-bs4 all 4.14.2-1 [116 kB] Fetched 116 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpqal1o10e/python3-bs4_4.14.2-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libgvc6 amd64 2.42.4-3 [686 kB] Fetched 686 kB in 0s (56.3 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpxhwixkag/libgvc6_2.42.4-3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 cmake amd64 4.1.1+really3.31.6-2 [12.2 MB] Fetched 12.2 MB in 0s (115 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmppst1yyng/cmake_4.1.1+really3.31.6-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libcrypt-dev amd64 1:4.5.1-1 [128 kB] Fetched 128 kB in 0s (11.9 MB/s) dpkg-name: info: moved 'libcrypt-dev_1%3a4.5.1-1_amd64.deb' to '/srv/rebuilderd/tmp/tmpdo9hmwbn/libcrypt-dev_4.5.1-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpkgconf3 amd64 1.8.1-4 [36.4 kB] Fetched 36.4 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpbpxb5p4u/libpkgconf3_1.8.1-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libblkid1 amd64 2.41.2-4 [174 kB] Fetched 174 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpxour3oqo/libblkid1_2.41.2-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 base-files amd64 14 [72.9 kB] Fetched 72.9 kB in 0s (6713 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpt5688r6k/base-files_14_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libbinutils amd64 2.45-8 [548 kB] Fetched 548 kB in 0s (45.0 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpqm0dmcgx/libbinutils_2.45-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 g++-15 amd64 15.2.0-8 [24.4 kB] Fetched 24.4 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpq_a3c9cx/g++-15_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-jinja2 all 3.1.6-1 [107 kB] Fetched 107 kB in 0s (10.6 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmphbwans8f/python3-jinja2_3.1.6-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-urllib3 all 2.5.0-1 [116 kB] Fetched 116 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmprxijlpeu/python3-urllib3_2.5.0-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libcrypt1 amd64 1:4.5.1-1 [98.0 kB] Fetched 98.0 kB in 0s (0 B/s) dpkg-name: info: moved 'libcrypt1_1%3a4.5.1-1_amd64.deb' to '/srv/rebuilderd/tmp/tmp6vpxlhol/libcrypt1_4.5.1-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 automake all 1:1.18.1-3 [878 kB] Fetched 878 kB in 0s (68.3 MB/s) dpkg-name: info: moved 'automake_1%3a1.18.1-3_all.deb' to '/srv/rebuilderd/tmp/tmply13cvnx/automake_1.18.1-3_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-snowballstemmer all 3.0.1-1 [63.5 kB] Fetched 63.5 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp5d8fozcr/python3-snowballstemmer_3.0.1-1_all.deb' Get:1 http://snapshot.debian.org/archive/debian/20251120T202450Z forky/main amd64 libdebconfclient0 amd64 0.281 [10.8 kB] Fetched 10.8 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp4qolioxb/libdebconfclient0_0.281_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 gettext-base amd64 0.23.2-1 [245 kB] Fetched 245 kB in 0s (24.4 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpp9o503ua/gettext-base_0.23.2-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-lxml amd64 6.0.2-1 [1447 kB] Fetched 1447 kB in 0s (86.8 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpsu5koqsy/python3-lxml_6.0.2-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 dwz amd64 0.16-2 [108 kB] Fetched 108 kB in 0s (10.6 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp82mxv7wx/dwz_0.16-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 tzdata all 2025b-5 [260 kB] Fetched 260 kB in 0s (25.9 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpvzj4dmn7/tzdata_2025b-5_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libgraphite2-3 amd64 1.3.14-11 [76.7 kB] Fetched 76.7 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpbg4unrcn/libgraphite2-3_1.3.14-11_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 g++ amd64 4:15.2.0-4 [1344 B] Fetched 1344 B in 0s (6364 B/s) dpkg-name: info: moved 'g++_4%3a15.2.0-4_amd64.deb' to '/srv/rebuilderd/tmp/tmp001jvx63/g++_15.2.0-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 fonts-dejavu-core all 2.37-8 [840 kB] Fetched 840 kB in 0s (4221 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmppq4bzyaw/fonts-dejavu-core_2.37-8_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 cpp amd64 4:15.2.0-4 [1564 B] Fetched 1564 B in 0s (0 B/s) dpkg-name: info: moved 'cpp_4%3a15.2.0-4_amd64.deb' to '/srv/rebuilderd/tmp/tmp_j1blmqg/cpp_15.2.0-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 cpp-15 amd64 15.2.0-8 [1276 B] Fetched 1276 B in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp3q0her6i/cpp-15_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libann0 amd64 1.1.2+doc-9+b1 [25.1 kB] Fetched 25.1 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmprnmz05ol/libann0_1.1.2+doc-9+b1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libxapian30 amd64 1.4.29-3 [1165 kB] Fetched 1165 kB in 0s (81.5 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpe4loss94/libxapian30_1.4.29-3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libcurl4t64 amd64 8.17.0-2 [409 kB] Fetched 409 kB in 0s (34.4 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp767o16n6/libcurl4t64_8.17.0-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libheif-plugin-libde265 amd64 1.20.2-2+b1 [17.7 kB] Fetched 17.7 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpn1ymh2ti/libheif-plugin-libde265_1.20.2-2+b1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 gcc amd64 4:15.2.0-4 [5160 B] Fetched 5160 B in 0s (0 B/s) dpkg-name: info: moved 'gcc_4%3a15.2.0-4_amd64.deb' to '/srv/rebuilderd/tmp/tmp5uv8jrv_/gcc_15.2.0-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 liblz4-1 amd64 1.10.0-6 [70.5 kB] Fetched 70.5 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp_b8wxy7e/liblz4-1_1.10.0-6_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libbsd0 amd64 0.12.2-2 [131 kB] Fetched 131 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp54zkdmm1/libbsd0_0.12.2-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-sphinxcontrib.jquery all 4.1-6 [7496 B] Fetched 7496 B in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp_cg5y8hc/python3-sphinxcontrib.jquery_4.1-6_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libreadline8t64 amd64 8.3-3 [191 kB] Fetched 191 kB in 0s (17.2 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp_zmf0v6b/libreadline8t64_8.3-3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libxcb1 amd64 1.17.0-2+b1 [144 kB] Fetched 144 kB in 0s (13.9 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpxr8i1bvm/libxcb1_1.17.0-2+b1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 procps amd64 2:4.0.4-9 [882 kB] Fetched 882 kB in 0s (68.8 MB/s) dpkg-name: info: moved 'procps_2%3a4.0.4-9_amd64.deb' to '/srv/rebuilderd/tmp/tmptst268x0/procps_4.0.4-9_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 binutils-x86-64-linux-gnu amd64 2.45-8 [1048 kB] Fetched 1048 kB in 0s (70.8 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp18y72imu/binutils-x86-64-linux-gnu_2.45-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libmagic-mgc amd64 1:5.46-5 [338 kB] Fetched 338 kB in 0s (24.9 MB/s) dpkg-name: info: moved 'libmagic-mgc_1%3a5.46-5_amd64.deb' to '/srv/rebuilderd/tmp/tmpjiz5wfy2/libmagic-mgc_5.46-5_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpcre2-8-0 amd64 10.46-1 [298 kB] Fetched 298 kB in 0s (25.7 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpnue7dl0y/libpcre2-8-0_10.46-1_amd64.deb' Get:1 http://snapshot.debian.org/archive/debian/20251120T202450Z forky/main amd64 ncurses-base all 6.5+20250216-2 [273 kB] Fetched 273 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpewiqbve3/ncurses-base_6.5+20250216-2_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 sphinx-rtd-theme-common all 3.0.2+dfsg-3 [1023 kB] Fetched 1023 kB in 0s (76.5 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpgsztxfx1/sphinx-rtd-theme-common_3.0.2+dfsg-3_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 sed amd64 4.9-2 [329 kB] Fetched 329 kB in 0s (31.2 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpc58lme57/sed_4.9-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libcdt5 amd64 2.42.4-3 [40.3 kB] Fetched 40.3 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmps_c8ivuj/libcdt5_2.42.4-3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 gcc-15-base amd64 15.2.0-8 [53.5 kB] Fetched 53.5 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp_gulbsr7/gcc-15-base_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-sphinx all 8.2.3-9 [477 kB] Fetched 477 kB in 0s (42.3 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp_lrcmtxp/python3-sphinx_8.2.3-9_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpam0g amd64 1.7.0-5 [69.9 kB] Fetched 69.9 kB in 0s (6435 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpdiawevlh/libpam0g_1.7.0-5_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 readline-common all 8.3-3 [74.8 kB] Fetched 74.8 kB in 0s (7253 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpm5fhsgym/readline-common_8.3-3_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpangoft2-1.0-0 amd64 1.56.3-2 [62.0 kB] Fetched 62.0 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpxz9d6jrl/libpangoft2-1.0-0_1.56.3-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 graphviz amd64 2.42.4-3 [621 kB] Fetched 621 kB in 0s (53.0 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpbtv0v_e0/graphviz_2.42.4-3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 doxygen amd64 1.9.8+ds-2.1 [5017 kB] Fetched 5017 kB in 0s (136 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmps4udvv5q/doxygen_1.9.8+ds-2.1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-docutils all 0.22.3+dfsg-1 [432 kB] Fetched 432 kB in 0s (36.4 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmps4kycj0x/python3-docutils_0.22.3+dfsg-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libavif16 amd64 1.3.0-1+b1 [137 kB] Fetched 137 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpyscl0utp/libavif16_1.3.0-1+b1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 man-db amd64 2.13.1-1 [1469 kB] Fetched 1469 kB in 0s (88.6 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmppjyux_jw/man-db_2.13.1-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 fontconfig-config amd64 2.15.0-2.4 [318 kB] Fetched 318 kB in 0s (31.2 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpe4ftrbuv/fontconfig-config_2.15.0-2.4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 cpp-15-x86-64-linux-gnu amd64 15.2.0-8 [12.1 MB] Fetched 12.1 MB in 0s (28.1 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpnfvmzyhe/cpp-15-x86-64-linux-gnu_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-requests all 2.32.5+dfsg-1 [72.4 kB] Fetched 72.4 kB in 0s (6779 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpuw6fgb5f/python3-requests_2.32.5+dfsg-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpython3-stdlib amd64 3.13.7-1 [10.2 kB] Fetched 10.2 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpqe_4w38d/libpython3-stdlib_3.13.7-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 bsdextrautils amd64 2.41.2-4 [98.5 kB] Fetched 98.5 kB in 0s (9444 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpsgg3xukm/bsdextrautils_2.41.2-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libunistring5 amd64 1.3-2 [477 kB] Fetched 477 kB in 0s (44.0 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp09dywtkj/libunistring5_1.3-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libgomp1 amd64 15.2.0-8 [140 kB] Fetched 140 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpfpw5cepd/libgomp1_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 m4 amd64 1.4.20-2 [325 kB] Fetched 325 kB in 0s (30.2 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpkpwz8ax4/m4_1.4.20-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-roman-numerals all 3.1.0-2 [8740 B] Fetched 8740 B in 0s (844 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp6_kc7sob/python3-roman-numerals_3.1.0-2_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 diffutils amd64 1:3.12-1 [405 kB] Fetched 405 kB in 0s (34.5 MB/s) dpkg-name: info: moved 'diffutils_1%3a3.12-1_amd64.deb' to '/srv/rebuilderd/tmp/tmpl6csnry6/diffutils_3.12-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 build-essential amd64 12.12 [4624 B] Fetched 4624 B in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmptk_zwn9j/build-essential_12.12_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libx11-data all 2:1.8.12-1 [343 kB] Fetched 343 kB in 0s (33.5 MB/s) dpkg-name: info: moved 'libx11-data_2%3a1.8.12-1_all.deb' to '/srv/rebuilderd/tmp/tmpsorxqkxq/libx11-data_1.8.12-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 cmake-data all 4.1.1+really3.31.6-2 [2268 kB] Fetched 2268 kB in 0s (105 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp0n7yzzs5/cmake-data_4.1.1+really3.31.6-2_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 dh-strip-nondeterminism all 1.15.0-1 [8812 B] Fetched 8812 B in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp5vlw9b24/dh-strip-nondeterminism_1.15.0-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libldap2 amd64 2.6.10+dfsg-1 [194 kB] Fetched 194 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpwny5s4j5/libldap2_2.6.10+dfsg-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 zlib1g-dev amd64 1:1.3.dfsg+really1.3.1-1+b1 [920 kB] Fetched 920 kB in 0s (67.3 MB/s) dpkg-name: info: moved 'zlib1g-dev_1%3a1.3.dfsg+really1.3.1-1+b1_amd64.deb' to '/srv/rebuilderd/tmp/tmpmfh9wdpp/zlib1g-dev_1.3.dfsg+really1.3.1-1+b1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpixman-1-0 amd64 0.46.4-1 [259 kB] Fetched 259 kB in 0s (25.2 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp74bub1t8/libpixman-1-0_0.46.4-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-typing-extensions all 4.15.0-1 [92.4 kB] Fetched 92.4 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpf_1huy6p/python3-typing-extensions_4.15.0-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libsvtav1enc2 amd64 2.3.0+dfsg-1 [2489 kB] Fetched 2489 kB in 1s (3732 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpewf43qnt/libsvtav1enc2_2.3.0+dfsg-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-certifi all 2025.1.31+ds-1 [9652 B] Fetched 9652 B in 0s (37.6 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpolh7edxi/python3-certifi_2025.1.31+ds-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libcgraph6 amd64 2.42.4-3 [64.0 kB] Fetched 64.0 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpf06fh17l/libcgraph6_2.42.4-3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 rpcsvc-proto amd64 1.4.3-1 [63.3 kB] Fetched 63.3 kB in 0s (6140 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpg2hr4vgw/rpcsvc-proto_1.4.3-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 liblzma5 amd64 5.8.1-2 [310 kB] Fetched 310 kB in 0s (27.0 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpxo8zbvkz/liblzma5_5.8.1-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libxpm4 amd64 1:3.5.17-1+b3 [56.2 kB] Fetched 56.2 kB in 0s (0 B/s) dpkg-name: info: moved 'libxpm4_1%3a3.5.17-1+b3_amd64.deb' to '/srv/rebuilderd/tmp/tmpz25au0qx/libxpm4_3.5.17-1+b3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libxrender1 amd64 1:0.9.12-1 [27.9 kB] Fetched 27.9 kB in 0s (0 B/s) dpkg-name: info: moved 'libxrender1_1%3a0.9.12-1_amd64.deb' to '/srv/rebuilderd/tmp/tmpv2whtozz/libxrender1_0.9.12-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 catch2 all 3.7.1-0.6 [5216 B] Fetched 5216 B in 0s (469 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpmt2xbwqt/catch2_3.7.1-0.6_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 gcc-15-x86-64-linux-gnu amd64 15.2.0-8 [23.3 MB] Fetched 23.3 MB in 0s (180 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpcavoshfr/gcc-15-x86-64-linux-gnu_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libxcb-render0 amd64 1.17.0-2+b1 [115 kB] Fetched 115 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpn7in28gi/libxcb-render0_1.17.0-2+b1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3.13-minimal amd64 3.13.9-1 [2257 kB] Fetched 2257 kB in 0s (111 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpa2y3ykmn/python3.13-minimal_3.13.9-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libsasl2-2 amd64 2.1.28+dfsg1-10 [57.8 kB] Fetched 57.8 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpurqiy0g2/libsasl2-2_2.1.28+dfsg1-10_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpython3.13-stdlib amd64 3.13.9-1 [1965 kB] Fetched 1965 kB in 0s (104 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpvvfphay4/libpython3.13-stdlib_3.13.9-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpam-modules-bin amd64 1.7.0-5 [49.1 kB] Fetched 49.1 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpv5b7fni5/libpam-modules-bin_1.7.0-5_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libxmu6 amd64 2:1.1.3-3+b4 [59.0 kB] Fetched 59.0 kB in 0s (0 B/s) dpkg-name: info: moved 'libxmu6_2%3a1.1.3-3+b4_amd64.deb' to '/srv/rebuilderd/tmp/tmpnjajwt0b/libxmu6_1.1.3-3+b4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libgcc-s1 amd64 15.2.0-8 [71.5 kB] Fetched 71.5 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp2wysi58a/libgcc-s1_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-six all 1.17.0-1 [16.5 kB] Fetched 16.5 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpv2xbe1rg/python3-six_1.17.0-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 mawk amd64 1.3.4.20250131-1 [141 kB] Fetched 141 kB in 0s (1237 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpn5k2mmjw/mawk_1.3.4.20250131-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 autotools-dev all 20240727.1 [60.2 kB] Fetched 60.2 kB in 0s (129 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp818yjndp/autotools-dev_20240727.1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libxt6t64 amd64 1:1.2.1-1.3 [208 kB] Fetched 208 kB in 0s (17.9 MB/s) dpkg-name: info: moved 'libxt6t64_1%3a1.2.1-1.3_amd64.deb' to '/srv/rebuilderd/tmp/tmpklxhosrt/libxt6t64_1.2.1-1.3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libjson-perl all 4.10000-1 [87.5 kB] Fetched 87.5 kB in 0s (7982 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmptq4b24fr/libjson-perl_4.10000-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libzstd1 amd64 1.5.7+dfsg-2 [308 kB] Fetched 308 kB in 0s (30.3 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpny6ckmb7/libzstd1_1.5.7+dfsg-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpangocairo-1.0-0 amd64 1.56.3-2 [38.1 kB] Fetched 38.1 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpqszhi2_y/libpangocairo-1.0-0_1.56.3-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpipeline1 amd64 1.5.8-1 [42.0 kB] Fetched 42.0 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp8ysahfcb/libpipeline1_1.5.8-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libattr1 amd64 1:2.5.2-3 [22.9 kB] Fetched 22.9 kB in 0s (2212 kB/s) dpkg-name: info: moved 'libattr1_1%3a2.5.2-3_amd64.deb' to '/srv/rebuilderd/tmp/tmpqibndkai/libattr1_2.5.2-3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-imagesize all 1.4.1-1 [6688 B] Fetched 6688 B in 0s (625 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp2lm_fkbn/python3-imagesize_1.4.1-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libdpkg-perl all 1.22.21 [650 kB] Fetched 650 kB in 0s (53.7 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpdxed56ua/libdpkg-perl_1.22.21_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libc6-dev amd64 2.41-12 [1991 kB] Fetched 1991 kB in 0s (102 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpyf76j_4y/libc6-dev_2.41-12_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libgcc-15-dev amd64 15.2.0-8 [2718 kB] Fetched 2718 kB in 0s (116 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpv2cvhi00/libgcc-15-dev_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libcap2 amd64 1:2.75-10+b1 [28.8 kB] Fetched 28.8 kB in 0s (0 B/s) dpkg-name: info: moved 'libcap2_1%3a2.75-10+b1_amd64.deb' to '/srv/rebuilderd/tmp/tmphixqwfm5/libcap2_2.75-10+b1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libcc1-0 amd64 15.2.0-8 [42.8 kB] Fetched 42.8 kB in 0s (4135 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpewrvnf8y/libcc1-0_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-chardet all 5.2.0+dfsg-2 [108 kB] Fetched 108 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpr73ymj71/python3-chardet_5.2.0+dfsg-2_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 fonts-dejavu-mono all 2.37-8 [489 kB] Fetched 489 kB in 0s (39.8 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpm8vwnpo8/fonts-dejavu-mono_2.37-8_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 patch amd64 2.8-2 [134 kB] Fetched 134 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmptokubi70/patch_2.8-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libsharpyuv0 amd64 1.5.0-0.1 [116 kB] Fetched 116 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpbff5vr4y/libsharpyuv0_1.5.0-0.1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-mdurl all 0.1.2-1 [9444 B] Fetched 9444 B in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpjfx1i_3m/python3-mdurl_0.1.2-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libtiff6 amd64 4.7.1-1 [361 kB] Fetched 361 kB in 0s (32.7 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpmc5b4h5j/libtiff6_4.7.1-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 hostname amd64 3.25 [11.0 kB] Fetched 11.0 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpj87k3g4u/hostname_3.25_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 linux-libc-dev all 6.17.8-1 [2552 kB] Fetched 2552 kB in 0s (115 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpy3gbg6xk/linux-libc-dev_6.17.8-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 openssl-provider-legacy amd64 3.5.4-1 [308 kB] Fetched 308 kB in 0s (30.3 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp1hu3fnhx/openssl-provider-legacy_3.5.4-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libacl1 amd64 2.3.2-2+b1 [32.9 kB] Fetched 32.9 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpee3c1wt1/libacl1_2.3.2-2+b1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libclang1-19 amd64 1:19.1.7-10.1 [7724 kB] Fetched 7724 kB in 0s (158 MB/s) dpkg-name: info: moved 'libclang1-19_1%3a19.1.7-10.1_amd64.deb' to '/srv/rebuilderd/tmp/tmpt8svme1c/libclang1-19_19.1.7-10.1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 coreutils amd64 9.7-3 [3024 kB] Fetched 3024 kB in 0s (125 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp_vhfienk/coreutils_9.7-3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libsystemd0 amd64 259~rc1-1 [469 kB] Fetched 469 kB in 0s (39.0 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpgvtu7ojx/libsystemd0_259~rc1-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libharfbuzz0b amd64 12.1.0-1 [530 kB] Fetched 530 kB in 0s (42.3 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp2q0bqjnp/libharfbuzz0b_12.1.0-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libkeyutils1 amd64 1.6.3-6 [9456 B] Fetched 9456 B in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpyvf7y5cp/libkeyutils1_1.6.3-6_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libquadmath0 amd64 15.2.0-8 [145 kB] Fetched 145 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpdxyntnll/libquadmath0_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libxcb-shm0 amd64 1.17.0-2+b1 [105 kB] Fetched 105 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpbhru42p9/libxcb-shm0_1.17.0-2+b1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libthai-data all 0.1.29-2 [168 kB] Fetched 168 kB in 0s (16.7 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpi0nkw8oy/libthai-data_0.1.29-2_all.deb' Downloading dependency 1 of 328: dash:amd64=0.5.12-12 Downloading dependency 2 of 328: libjs-sphinxdoc:amd64=8.2.3-9 Downloading dependency 3 of 328: libpam-runtime:amd64=1.7.0-5 Downloading dependency 4 of 328: xz-utils:amd64=5.8.1-2 Downloading dependency 5 of 328: libarchive13t64:amd64=3.7.4-4+b1 Downloading dependency 6 of 328: g++-15-x86-64-linux-gnu:amd64=15.2.0-8 Downloading dependency 7 of 328: libz3-4:amd64=4.13.3-1 Downloading dependency 8 of 328: binutils:amd64=2.45-8 Downloading dependency 9 of 328: libmpfr6:amd64=4.2.2-2 Downloading dependency 10 of 328: libtool:amd64=2.5.4-7 Downloading dependency 11 of 328: po-debconf:amd64=1.0.21+nmu1 Downloading dependency 12 of 328: python3-bs4:amd64=4.14.2-1 Downloading dependency 13 of 328: libgvc6:amd64=2.42.4-3 Downloading dependency 14 of 328: cmake:amd64=4.1.1+really3.31.6-2 Downloading dependency 15 of 328: libcrypt-dev:amd64=1:4.5.1-1 Downloading dependency 16 of 328: libpkgconf3:amd64=1.8.1-4 Downloading dependency 17 of 328: libblkid1:amd64=2.41.2-4 Downloading dependency 18 of 328: base-files:amd64=14 Downloading dependency 19 of 328: libbinutils:amd64=2.45-8 Downloading dependency 20 of 328: g++-15:amd64=15.2.0-8 Downloading dependency 21 of 328: python3-jinja2:amd64=3.1.6-1 Downloading dependency 22 of 328: python3-urllib3:amd64=2.5.0-1 Downloading dependency 23 of 328: libcrypt1:amd64=1:4.5.1-1 Downloading dependency 24 of 328: automake:amd64=1:1.18.1-3 Downloading dependency 25 of 328: python3-snowballstemmer:amd64=3.0.1-1 Downloading dependency 26 of 328: libdebconfclient0:amd64=0.281 Downloading dependency 27 of 328: gettext-base:amd64=0.23.2-1 Downloading dependency 28 of 328: python3-lxml:amd64=6.0.2-1 Downloading dependency 29 of 328: dwz:amd64=0.16-2 Downloading dependency 30 of 328: tzdata:amd64=2025b-5 Downloading dependency 31 of 328: libgraphite2-3:amd64=1.3.14-11 Downloading dependency 32 of 328: g++:amd64=4:15.2.0-4 Downloading dependency 33 of 328: fonts-dejavu-core:amd64=2.37-8 Downloading dependency 34 of 328: cpp:amd64=4:15.2.0-4 Downloading dependency 35 of 328: cpp-15:amd64=15.2.0-8 Downloading dependency 36 of 328: libann0:amd64=1.1.2+doc-9+b1 Downloading dependency 37 of 328: libxapian30:amd64=1.4.29-3 Downloading dependency 38 of 328: libcurl4t64:amd64=8.17.0-2 Downloading dependency 39 of 328: libheif-plugin-libde265:amd64=1.20.2-2+b1 Downloading dependency 40 of 328: gcc:amd64=4:15.2.0-4 Downloading dependency 41 of 328: liblz4-1:amd64=1.10.0-6 Downloading dependency 42 of 328: libbsd0:amd64=0.12.2-2 Downloading dependency 43 of 328: python3-sphinxcontrib.jquery:amd64=4.1-6 Downloading dependency 44 of 328: libreadline8t64:amd64=8.3-3 Downloading dependency 45 of 328: libxcb1:amd64=1.17.0-2+b1 Downloading dependency 46 of 328: procps:amd64=2:4.0.4-9 Downloading dependency 47 of 328: binutils-x86-64-linux-gnu:amd64=2.45-8 Downloading dependency 48 of 328: libmagic-mgc:amd64=1:5.46-5 Downloading dependency 49 of 328: libpcre2-8-0:amd64=10.46-1 Downloading dependency 50 of 328: ncurses-base:amd64=6.5+20250216-2 Downloading dependency 51 of 328: sphinx-rtd-theme-common:amd64=3.0.2+dfsg-3 Downloading dependency 52 of 328: sed:amd64=4.9-2 Downloading dependency 53 of 328: libcdt5:amd64=2.42.4-3 Downloading dependency 54 of 328: gcc-15-base:amd64=15.2.0-8 Downloading dependency 55 of 328: python3-sphinx:amd64=8.2.3-9 Downloading dependency 56 of 328: libpam0g:amd64=1.7.0-5 Downloading dependency 57 of 328: readline-common:amd64=8.3-3 Downloading dependency 58 of 328: libpangoft2-1.0-0:amd64=1.56.3-2 Downloading dependency 59 of 328: graphviz:amd64=2.42.4-3 Downloading dependency 60 of 328: doxygen:amd64=1.9.8+ds-2.1 Downloading dependency 61 of 328: python3-docutils:amd64=0.22.3+dfsg-1 Downloading dependency 62 of 328: libavif16:amd64=1.3.0-1+b1 Downloading dependency 63 of 328: man-db:amd64=2.13.1-1 Downloading dependency 64 of 328: fontconfig-config:amd64=2.15.0-2.4 Downloading dependency 65 of 328: cpp-15-x86-64-linux-gnu:amd64=15.2.0-8 Downloading dependency 66 of 328: python3-requests:amd64=2.32.5+dfsg-1 Downloading dependency 67 of 328: libpython3-stdlib:amd64=3.13.7-1 Downloading dependency 68 of 328: bsdextrautils:amd64=2.41.2-4 Downloading dependency 69 of 328: libunistring5:amd64=1.3-2 Downloading dependency 70 of 328: libgomp1:amd64=15.2.0-8 Downloading dependency 71 of 328: m4:amd64=1.4.20-2 Downloading dependency 72 of 328: python3-roman-numerals:amd64=3.1.0-2 Downloading dependency 73 of 328: diffutils:amd64=1:3.12-1 Downloading dependency 74 of 328: build-essential:amd64=12.12 Downloading dependency 75 of 328: libx11-data:amd64=2:1.8.12-1 Downloading dependency 76 of 328: cmake-data:amd64=4.1.1+really3.31.6-2 Downloading dependency 77 of 328: dh-strip-nondeterminism:amd64=1.15.0-1 Downloading dependency 78 of 328: libldap2:amd64=2.6.10+dfsg-1 Downloading dependency 79 of 328: zlib1g-dev:amd64=1:1.3.dfsg+really1.3.1-1+b1 Downloading dependency 80 of 328: libpixman-1-0:amd64=0.46.4-1 Downloading dependency 81 of 328: python3-typing-extensions:amd64=4.15.0-1 Downloading dependency 82 of 328: libsvtav1enc2:amd64=2.3.0+dfsg-1 Downloading dependency 83 of 328: python3-certifi:amd64=2025.1.31+ds-1 Downloading dependency 84 of 328: libcgraph6:amd64=2.42.4-3 Downloading dependency 85 of 328: rpcsvc-proto:amd64=1.4.3-1 Downloading dependency 86 of 328: liblzma5:amd64=5.8.1-2 Downloading dependency 87 of 328: libxpm4:amd64=1:3.5.17-1+b3 Downloading dependency 88 of 328: libxrender1:amd64=1:0.9.12-1 Downloading dependency 89 of 328: catch2:amd64=3.7.1-0.6 Downloading dependency 90 of 328: gcc-15-x86-64-linux-gnu:amd64=15.2.0-8 Downloading dependency 91 of 328: libxcb-render0:amd64=1.17.0-2+b1 Downloading dependency 92 of 328: python3.13-minimal:amd64=3.13.9-1 Downloading dependency 93 of 328: libsasl2-2:amd64=2.1.28+dfsg1-10 Downloading dependency 94 of 328: libpython3.13-stdlib:amd64=3.13.9-1 Downloading dependency 95 of 328: libpam-modules-bin:amd64=1.7.0-5 Downloading dependency 96 of 328: libxmu6:amd64=2:1.1.3-3+b4 Downloading dependency 97 of 328: libgcc-s1:amd64=15.2.0-8 Downloading dependency 98 of 328: python3-six:amd64=1.17.0-1 Downloading dependency 99 of 328: mawk:amd64=1.3.4.20250131-1 Downloading dependency 100 of 328: autotools-dev:amd64=20240727.1 Downloading dependency 101 of 328: libxt6t64:amd64=1:1.2.1-1.3 Downloading dependency 102 of 328: libjson-perl:amd64=4.10000-1 Downloading dependency 103 of 328: libzstd1:amd64=1.5.7+dfsg-2 Downloading dependency 104 of 328: libpangocairo-1.0-0:amd64=1.56.3-2 Downloading dependency 105 of 328: libpipeline1:amd64=1.5.8-1 Downloading dependency 106 of 328: libattr1:amd64=1:2.5.2-3 Downloading dependency 107 of 328: python3-imagesize:amd64=1.4.1-1 Downloading dependency 108 of 328: libdpkg-perl:amd64=1.22.21 Downloading dependency 109 of 328: libc6-dev:amd64=2.41-12 Downloading dependency 110 of 328: libgcc-15-dev:amd64=15.2.0-8 Downloading dependency 111 of 328: libcap2:amd64=1:2.75-10+b1 Downloading dependency 112 of 328: libcc1-0:amd64=15.2.0-8 Downloading dependency 113 of 328: python3-chardet:amd64=5.2.0+dfsg-2 Downloading dependency 114 of 328: fonts-dejavu-mono:amd64=2.37-8 Downloading dependency 115 of 328: patch:amd64=2.8-2 Downloading dependency 116 of 328: libsharpyuv0:amd64=1.5.0-0.1 Downloading dependency 117 of 328: python3-mdurl:amd64=0.1.2-1 Downloading dependency 118 of 328: libtiff6:amd64=4.7.1-1 Downloading dependency 119 of 328: hostname:amd64=3.25 Downloading dependency 120 of 328: linux-libc-dev:amd64=6.17.8-1 Downloading dependency 121 of 328: openssl-provider-legacy:amd64=3.5.4-1 Downloading dependency 122 of 328: libacl1:amd64=2.3.2-2+b1 Downloading dependency 123 of 328: libclang1-19:amd64=1:19.1.7-10.1 Downloading dependency 124 of 328: coreutils:amd64=9.7-3 Downloading dependency 125 of 328: libsystemd0:amd64=259~rc1-1 Downloading dependency 126 of 328: libharfbuzz0b:amd64=12.1.0-1 Downloading dependency 127 of 328: libkeyutils1:amd64=1.6.3-6 Downloading dependency 128 of 328: libquadmath0:amd64=15.2.0-8 Downloading dependency 129 of 328: libxcb-shm0:amd64=1.17.0-2+b1 Downloading dependency 130 of 328: libthai-data:amd64=0.1.29-2 Downloading dependency 131 of 328: libimagequant0:amd64=4.4.0-3Get:1 http://deb.debian.org/debian unstable/main amd64 libimagequant0 amd64 4.4.0-3 [251 kB] Fetched 251 kB in 0s (23.2 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp2m8g5d8l/libimagequant0_4.4.0-3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 pkg-config amd64 1.8.1-4 [14.0 kB] Fetched 14.0 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpjw4ffxc_/pkg-config_1.8.1-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-packaging all 25.0-1 [56.6 kB] Fetched 56.6 kB in 0s (5611 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp6xyr8ie_/python3-packaging_25.0-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libdb5.3t64 amd64 5.3.28+dfsg2-10 [709 kB] Fetched 709 kB in 0s (57.0 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpj9v_0qlq/libdb5.3t64_5.3.28+dfsg2-10_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libfile-stripnondeterminism-perl all 1.15.0-1 [19.9 kB] Fetched 19.9 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpnq6nn_ch/libfile-stripnondeterminism-perl_1.15.0-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libsframe2 amd64 2.45-8 [80.3 kB] Fetched 80.3 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmplom70r6w/libsframe2_2.45-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-pygments all 2.18.0+dfsg-2 [836 kB] Fetched 836 kB in 0s (55.5 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpe5v1z2vk/python3-pygments_2.18.0+dfsg-2_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 liblerc4 amd64 4.0.0+ds-5 [183 kB] Fetched 183 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp0i2toq9y/liblerc4_4.0.0+ds-5_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 dpkg-dev all 1.22.21 [1338 kB] Fetched 1338 kB in 0s (76.1 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpajd_bqaa/dpkg-dev_1.22.21_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-idna all 3.10-1 [42.0 kB] Fetched 42.0 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp5xkcbsc5/python3-idna_3.10-1_all.deb' Get:1 http://snapshot.debian.org/archive/debian/20251120T202450Z forky/main amd64 libncursesw6 amd64 6.5+20250216-2 [135 kB] Fetched 135 kB in 0s (13.4 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmplgy6jdzm/libncursesw6_6.5+20250216-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 make amd64 4.4.1-3 [463 kB] Fetched 463 kB in 0s (32.1 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpee3x39at/make_4.4.1-3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-mdit-py-plugins all 0.5.0-1 [33.4 kB] Fetched 33.4 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp423ei7qg/python3-mdit-py-plugins_0.5.0-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libxdmcp6 amd64 1:1.1.5-1 [27.8 kB] Fetched 27.8 kB in 0s (0 B/s) dpkg-name: info: moved 'libxdmcp6_1%3a1.1.5-1_amd64.deb' to '/srv/rebuilderd/tmp/tmpxdkz9cb_/libxdmcp6_1.1.5-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 sensible-utils all 0.0.26 [27.0 kB] Fetched 27.0 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp2jq1slow/sensible-utils_0.0.26_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libudev1 amd64 259~rc1-1 [157 kB] Fetched 157 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpay19w14u/libudev1_259~rc1-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libbrotli1 amd64 1.1.0-2+b7 [307 kB] Fetched 307 kB in 0s (29.1 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpqsv952b3/libbrotli1_1.1.0-2+b7_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 ca-certificates all 20250419 [162 kB] Fetched 162 kB in 0s (14.5 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpro3j9nmh/ca-certificates_20250419_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 librav1e0.8 amd64 0.8.1-6 [978 kB] Fetched 978 kB in 0s (71.8 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpr5xp0jvx/librav1e0.8_0.8.1-6_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libfmt10 amd64 10.1.1+ds1-4 [127 kB] Fetched 127 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpsv1fgosj/libfmt10_10.1.1+ds1-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libxslt1.1 amd64 1.1.43-0.3 [158 kB] Fetched 158 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpspdj8ntz/libxslt1.1_1.1.43-0.3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 zlib1g amd64 1:1.3.dfsg+really1.3.1-1+b1 [88.9 kB] Fetched 88.9 kB in 0s (0 B/s) dpkg-name: info: moved 'zlib1g_1%3a1.3.dfsg+really1.3.1-1+b1_amd64.deb' to '/srv/rebuilderd/tmp/tmpy7v9ficr/zlib1g_1.3.dfsg+really1.3.1-1+b1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 perl amd64 5.40.1-7 [267 kB] Fetched 267 kB in 0s (26.0 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpiz3qv197/perl_5.40.1-7_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 tar amd64 1.35+dfsg-3.1 [815 kB] Fetched 815 kB in 0s (61.0 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmphojk4yv7/tar_1.35+dfsg-3.1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libhwasan0 amd64 15.2.0-8 [1538 kB] Fetched 1538 kB in 0s (81.7 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmphpr_hc93/libhwasan0_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 findutils amd64 4.10.0-3 [700 kB] Fetched 700 kB in 0s (50.9 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmphz1ktucp/findutils_4.10.0-3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libkrb5support0 amd64 1.22.1-2 [33.1 kB] Fetched 33.1 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp87dd_24f/libkrb5support0_1.22.1-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libxau6 amd64 1:1.0.11-1 [20.4 kB] Fetched 20.4 kB in 0s (0 B/s) dpkg-name: info: moved 'libxau6_1%3a1.0.11-1_amd64.deb' to '/srv/rebuilderd/tmp/tmpswy44gf4/libxau6_1.0.11-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libyuv0 amd64 0.0.1919.20250919-1 [175 kB] Fetched 175 kB in 0s (16.8 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpwaw7umjt/libyuv0_0.0.1919.20250919-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 cpp-x86-64-linux-gnu amd64 4:15.2.0-4 [5292 B] Fetched 5292 B in 0s (524 kB/s) dpkg-name: info: moved 'cpp-x86-64-linux-gnu_4%3a15.2.0-4_amd64.deb' to '/srv/rebuilderd/tmp/tmph5pnw7p0/cpp-x86-64-linux-gnu_15.2.0-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-defusedxml all 0.7.1-3 [43.4 kB] Fetched 43.4 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpy0hban9w/python3-defusedxml_0.7.1-3_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 g++-x86-64-linux-gnu amd64 4:15.2.0-4 [1196 B] Fetched 1196 B in 0s (0 B/s) dpkg-name: info: moved 'g++-x86-64-linux-gnu_4%3a15.2.0-4_amd64.deb' to '/srv/rebuilderd/tmp/tmpgeszfbim/g++-x86-64-linux-gnu_15.2.0-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 binutils-common amd64 2.45-8 [2558 kB] Fetched 2558 kB in 0s (110 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp8qmz17c4/binutils-common_2.45-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpcre2-16-0 amd64 10.46-1 [281 kB] Fetched 281 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpcdg8gq0i/libpcre2-16-0_10.46-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 x11-common all 1:7.7+26 [217 kB] Fetched 217 kB in 0s (0 B/s) dpkg-name: info: moved 'x11-common_1%3a7.7+26_all.deb' to '/srv/rebuilderd/tmp/tmpa3nihdx6/x11-common_7.7+26_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libffi8 amd64 3.5.2-2 [25.5 kB] Fetched 25.5 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpklooascm/libffi8_3.5.2-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libgts-0.7-5t64 amd64 0.7.6+darcs121130-5.2+b1 [160 kB] Fetched 160 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpu2_ilfu8/libgts-0.7-5t64_0.7.6+darcs121130-5.2+b1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libasan8 amd64 15.2.0-8 [2779 kB] Fetched 2779 kB in 0s (112 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpa3wvksij/libasan8_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libaudit1 amd64 1:4.1.2-1 [60.4 kB] Fetched 60.4 kB in 0s (0 B/s) dpkg-name: info: moved 'libaudit1_1%3a4.1.2-1_amd64.deb' to '/srv/rebuilderd/tmp/tmp2trczoss/libaudit1_4.1.2-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 dpkg amd64 1.22.21 [1538 kB] Fetched 1538 kB in 0s (86.1 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpq803g8hd/dpkg_1.22.21_amd64.deb' Get:1 http://snapshot.debian.org/archive/debian/20251120T202450Z forky/main amd64 librhash1 amd64 1.4.6-1 [137 kB] Fetched 137 kB in 0s (12.5 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp4fetfgq5/librhash1_1.4.6-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libxml2-16 amd64 2.15.1+dfsg-0.4 [640 kB] Fetched 640 kB in 0s (52.5 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpjmyosbj1/libxml2-16_2.15.1+dfsg-0.4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libp11-kit0 amd64 0.25.10-1 [444 kB] Fetched 444 kB in 0s (41.0 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp70xtbobv/libp11-kit0_0.25.10-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 liblab-gamut1 amd64 2.42.4-3 [198 kB] Fetched 198 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpm8ixedgf/liblab-gamut1_2.42.4-3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 sgml-base all 1.31+nmu1 [10.9 kB] Fetched 10.9 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpimeg2xpr/sgml-base_1.31+nmu1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3.13 amd64 3.13.9-1 [764 kB] Fetched 764 kB in 0s (56.9 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpd9btx199/python3.13_3.13.9-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libfontconfig1 amd64 2.15.0-2.4 [401 kB] Fetched 401 kB in 0s (34.1 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp723ou66a/libfontconfig1_2.15.0-2.4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libisl23 amd64 0.27-1 [659 kB] Fetched 659 kB in 0s (53.8 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp1zpm9v61/libisl23_0.27-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libngtcp2-16 amd64 1.16.0-1 [136 kB] Fetched 136 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmppti9p5d2/libngtcp2-16_1.16.0-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpam-modules amd64 1.7.0-5 [179 kB] Fetched 179 kB in 0s (17.7 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp3igxa_sf/libpam-modules_1.7.0-5_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libjbig0 amd64 2.1-6.1+b2 [32.1 kB] Fetched 32.1 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp4r2os3lj/libjbig0_2.1-6.1+b2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libnettle8t64 amd64 3.10.2-1 [307 kB] Fetched 307 kB in 0s (29.8 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpsaxnatlc/libnettle8t64_3.10.2-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libselinux1 amd64 3.9-2 [85.4 kB] Fetched 85.4 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpvksu6aqn/libselinux1_3.9-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3 amd64 3.13.7-1 [28.3 kB] Fetched 28.3 kB in 0s (2817 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpdjz5_knu/python3_3.13.7-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libdatrie1 amd64 0.2.13-4 [38.0 kB] Fetched 38.0 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpcl6k54a1/libdatrie1_0.2.13-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libssl3t64 amd64 3.5.4-1 [2446 kB] Fetched 2446 kB in 0s (107 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpi6kuqeav/libssl3t64_3.5.4-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libc-bin amd64 2.41-12 [637 kB] Fetched 637 kB in 0s (50.5 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmps9ipblwt/libc-bin_2.41-12_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libseccomp2 amd64 2.6.0-2 [51.7 kB] Fetched 51.7 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpy4su894g/libseccomp2_2.6.0-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libbz2-1.0 amd64 1.0.8-6 [37.9 kB] Fetched 37.9 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpy8frkl8o/libbz2-1.0_1.0.8-6_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libngtcp2-crypto-ossl0 amd64 1.16.0-1 [27.5 kB] Fetched 27.5 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpy0ztrt20/libngtcp2-crypto-ossl0_1.16.0-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 bzip2 amd64 1.0.8-6 [40.5 kB] Fetched 40.5 kB in 0s (3658 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp4c_qga_r/bzip2_1.0.8-6_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-markdown-it all 3.0.0-3 [59.5 kB] Fetched 59.5 kB in 0s (5932 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp913iztb5/python3-markdown-it_3.0.0-3_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libthai0 amd64 0.1.29-2+b1 [49.4 kB] Fetched 49.4 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpc8ywl02_/libthai0_0.1.29-2+b1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python-babel-localedata all 2.17.0-1 [6050 kB] Fetched 6050 kB in 0s (132 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp3o_fejpr/python-babel-localedata_2.17.0-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 netbase all 6.5 [12.4 kB] Fetched 12.4 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpj20q53o_/netbase_6.5_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libdebhelper-perl all 13.28 [92.4 kB] Fetched 92.4 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpm562hxh6/libdebhelper-perl_13.28_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 grep amd64 3.12-1 [443 kB] Fetched 443 kB in 0s (41.5 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpwyfg_owc/grep_3.12-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libyaml-0-2 amd64 0.2.5-2 [52.5 kB] Fetched 52.5 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpc_3nhmrw/libyaml-0-2_0.2.5-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-breathe all 4.36.0-2 [81.0 kB] Fetched 81.0 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmptdowx9op/python3-breathe_4.36.0-2_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libdav1d7 amd64 1.5.2-1 [564 kB] Fetched 564 kB in 0s (47.7 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpltcrl_aw/libdav1d7_1.5.2-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-minimal amd64 3.13.7-1 [27.2 kB] Fetched 27.2 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp8rmsy862/python3-minimal_3.13.7-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libheif1 amd64 1.20.2-2+b1 [601 kB] Fetched 601 kB in 0s (48.4 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmphukbhcf0/libheif1_1.20.2-2+b1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libgcrypt20 amd64 1.11.2-3 [871 kB] Fetched 871 kB in 0s (63.2 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpn93yibs4/libgcrypt20_1.11.2-3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libjs-jquery all 3.7.1+dfsg+~3.5.33-1 [319 kB] Fetched 319 kB in 0s (29.5 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp31am_paj/libjs-jquery_3.7.1+dfsg+~3.5.33-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-uc-micro all 1.0.3-1 [5744 B] Fetched 5744 B in 0s (539 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpobd4dejd/python3-uc-micro_1.0.3-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libelf1t64 amd64 0.194-1 [185 kB] Fetched 185 kB in 0s (16.5 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp4hqeqhea/libelf1t64_0.194-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-yaml amd64 6.0.2-2 [137 kB] Fetched 137 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpekyy4dfz/python3-yaml_6.0.2-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 util-linux amd64 2.41.2-4 [1163 kB] Fetched 1163 kB in 0s (77.8 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp9y_m6l75/util-linux_2.41.2-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpcre2-posix3 amd64 10.46-1 [63.9 kB] Fetched 63.9 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp7_49zd9r/libpcre2-posix3_10.46-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libnghttp3-9 amd64 1.12.0-1 [68.4 kB] Fetched 68.4 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp3dkk9ws2/libnghttp3-9_1.12.0-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libssh2-1t64 amd64 1.11.1-1 [245 kB] Fetched 245 kB in 0s (24.1 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp0yhm66fb/libssh2-1t64_1.11.1-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-myst-parser all 4.0.1-1 [78.8 kB] Fetched 78.8 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpg0m8jsk7/python3-myst-parser_4.0.1-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 sysvinit-utils amd64 3.15-6 [35.0 kB] Fetched 35.0 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp3e_1srhy/sysvinit-utils_3.15-6_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libhogweed6t64 amd64 3.10.2-1 [336 kB] Fetched 336 kB in 0s (31.4 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp8ozt8kic/libhogweed6t64_3.10.2-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libgmp10 amd64 2:6.3.0+dfsg-5 [574 kB] Fetched 574 kB in 0s (48.7 MB/s) dpkg-name: info: moved 'libgmp10_2%3a6.3.0+dfsg-5_amd64.deb' to '/srv/rebuilderd/tmp/tmpry_ovl7v/libgmp10_6.3.0+dfsg-5_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libgav1-1 amd64 0.19.0-3+b1 [353 kB] Fetched 353 kB in 0s (28.9 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmphov1xflo/libgav1-1_0.19.0-3+b1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 media-types all 14.0.0 [30.8 kB] Fetched 30.8 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp4t1jdc7t/media-types_14.0.0_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libstdc++-15-dev amd64 15.2.0-8 [2444 kB] Fetched 2444 kB in 0s (110 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp74ske96f/libstdc++-15-dev_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libcom-err2 amd64 1.47.2-3+b3 [25.0 kB] Fetched 25.0 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpr1oenriq/libcom-err2_1.47.2-3+b3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 sphinx-common all 8.2.3-9 [619 kB] Fetched 619 kB in 0s (48.7 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpdjj39xdn/sphinx-common_8.2.3-9_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libde265-0 amd64 1.0.16-1 [189 kB] Fetched 189 kB in 0s (16.8 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp2zx3x01q/libde265-0_1.0.16-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libc-dev-bin amd64 2.41-12 [58.2 kB] Fetched 58.2 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpfxx29t7_/libc-dev-bin_2.41-12_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-exhale all 0.3.7-1 [86.6 kB] Fetched 86.6 kB in 0s (868 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpl0si2jmj/python3-exhale_0.3.7-1_all.deb' Get:1 http://snapshot.debian.org/archive/debian/20251120T202450Z forky/main amd64 ncurses-bin amd64 6.5+20250216-2 [438 kB] Fetched 438 kB in 0s (36.0 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpq38cra_1/ncurses-bin_6.5+20250216-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libgnutls30t64 amd64 3.8.10-3 [1493 kB] Fetched 1493 kB in 0s (83.0 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp5tjseua2/libgnutls30t64_3.8.10-3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-charset-normalizer amd64 3.4.3-1 [131 kB] Fetched 131 kB in 0s (12.0 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp6_thqudh/python3-charset-normalizer_3.4.3-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libmagic1t64 amd64 1:5.46-5 [109 kB] Fetched 109 kB in 0s (0 B/s) dpkg-name: info: moved 'libmagic1t64_1%3a5.46-5_amd64.deb' to '/srv/rebuilderd/tmp/tmp5_aumdtk/libmagic1t64_5.46-5_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libtasn1-6 amd64 4.20.0-2 [49.9 kB] Fetched 49.9 kB in 0s (4940 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp55ra02r4/libtasn1-6_4.20.0-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libexpat1 amd64 2.7.3-1 [112 kB] Fetched 112 kB in 0s (10.9 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpw451wgem/libexpat1_2.7.3-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 fonts-lato all 2.015-1 [2780 kB] Fetched 2780 kB in 0s (116 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpe8qhhr0s/fonts-lato_2.015-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libstdc++6 amd64 15.2.0-8 [736 kB] Fetched 736 kB in 0s (53.6 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpllzd0un0/libstdc++6_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 dh-autoreconf all 21 [12.2 kB] Fetched 12.2 kB in 0s (1166 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpj38k7iid/dh-autoreconf_21_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libarchive-zip-perl all 1.68-1 [104 kB] Fetched 104 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp7bipitb9/libarchive-zip-perl_1.68-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-sphinx-rtd-theme all 3.0.2+dfsg-3 [29.7 kB] Fetched 29.7 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpyfx4nz6g/python3-sphinx-rtd-theme_3.0.2+dfsg-3_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpcre2-dev amd64 10.46-1 [853 kB] Fetched 853 kB in 0s (62.1 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpvv4k0a8i/libpcre2-dev_10.46-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libllvm19 amd64 1:19.1.7-10.1 [26.0 MB] Fetched 26.0 MB in 0s (177 MB/s) dpkg-name: info: moved 'libllvm19_1%3a19.1.7-10.1_amd64.deb' to '/srv/rebuilderd/tmp/tmpbgva_xa8/libllvm19_19.1.7-10.1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpython3.13-minimal amd64 3.13.9-1 [865 kB] Fetched 865 kB in 0s (63.7 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpa175n972/libpython3.13-minimal_3.13.9-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 pkgconf amd64 1.8.1-4 [26.2 kB] Fetched 26.2 kB in 0s (2483 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpe0gypbax/pkgconf_1.8.1-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libidn2-0 amd64 2.3.8-4 [110 kB] Fetched 110 kB in 0s (10.3 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp43ossbvw/libidn2-0_2.3.8-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libctf0 amd64 2.45-8 [91.9 kB] Fetched 91.9 kB in 0s (8863 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpnzwrjin8/libctf0_2.45-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 fontconfig amd64 2.15.0-2.4 [464 kB] Fetched 464 kB in 0s (39.4 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpogw44s34/fontconfig_2.15.0-2.4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libmpc3 amd64 1.3.1-2 [55.8 kB] Fetched 55.8 kB in 0s (5454 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp4k219ml_/libmpc3_1.3.1-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libheif-plugin-dav1d amd64 1.20.2-2+b1 [19.1 kB] Fetched 19.1 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp3w375lv8/libheif-plugin-dav1d_1.20.2-2+b1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libxaw7 amd64 2:1.0.16-1 [212 kB] Fetched 212 kB in 0s (20.6 MB/s) dpkg-name: info: moved 'libxaw7_2%3a1.0.16-1_amd64.deb' to '/srv/rebuilderd/tmp/tmpigqtb5w_/libxaw7_1.0.16-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 docutils-common all 0.22.3+dfsg-1 [128 kB] Fetched 128 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp2at_20c3/docutils-common_0.22.3+dfsg-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 perl-base amd64 5.40.1-7 [1679 kB] Fetched 1679 kB in 0s (82.9 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpcq1hkm5x/perl-base_5.40.1-7_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 gcc-x86-64-linux-gnu amd64 4:15.2.0-4 [1436 B] Fetched 1436 B in 0s (0 B/s) dpkg-name: info: moved 'gcc-x86-64-linux-gnu_4%3a15.2.0-4_amd64.deb' to '/srv/rebuilderd/tmp/tmpcxjalhjl/gcc-x86-64-linux-gnu_15.2.0-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libltdl7 amd64 2.5.4-7 [416 kB] Fetched 416 kB in 0s (35.5 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmppob80sv6/libltdl7_2.5.4-7_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 intltool-debian all 0.35.0+20060710.6 [22.9 kB] Fetched 22.9 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpimk8m_lj/intltool-debian_0.35.0+20060710.6_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libglib2.0-0t64 amd64 2.86.2-1 [1547 kB] Fetched 1547 kB in 0s (90.4 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp94fdr9_q/libglib2.0-0t64_2.86.2-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libgprofng0 amd64 2.45-8 [814 kB] Fetched 814 kB in 0s (51.4 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpwe9at316/libgprofng0_2.45-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libgdbm6t64 amd64 1.26-1 [78.5 kB] Fetched 78.5 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpe1ky8uby/libgdbm6t64_1.26-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 xml-core all 0.19 [20.1 kB] Fetched 20.1 kB in 0s (1959 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpo216matx/xml-core_0.19_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpango-1.0-0 amd64 1.56.3-2 [239 kB] Fetched 239 kB in 0s (22.9 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpt9dfyt3d/libpango-1.0-0_1.56.3-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 gettext amd64 0.23.2-1 [1687 kB] Fetched 1687 kB in 0s (91.3 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpfu8foayr/gettext_0.23.2-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libgssapi-krb5-2 amd64 1.22.1-2 [139 kB] Fetched 139 kB in 0s (12.6 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp1rc1jhk1/libgssapi-krb5-2_1.22.1-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 base-passwd amd64 3.6.8 [54.6 kB] Fetched 54.6 kB in 0s (5156 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp34jku0k6/base-passwd_3.6.8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libkrb5-3 amd64 1.22.1-2 [337 kB] Fetched 337 kB in 0s (32.2 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpm9x5_uae/libkrb5-3_1.22.1-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libnghttp2-14 amd64 1.64.0-1.1+b1 [76.2 kB] Fetched 76.2 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmppazbr7t7/libnghttp2-14_1.64.0-1.1+b1_amd64.deb' Downloading dependency 132 of 328: pkg-config:amd64=1.8.1-4 Downloading dependency 133 of 328: python3-packaging:amd64=25.0-1 Downloading dependency 134 of 328: libdb5.3t64:amd64=5.3.28+dfsg2-10 Downloading dependency 135 of 328: libfile-stripnondeterminism-perl:amd64=1.15.0-1 Downloading dependency 136 of 328: libsframe2:amd64=2.45-8 Downloading dependency 137 of 328: python3-pygments:amd64=2.18.0+dfsg-2 Downloading dependency 138 of 328: liblerc4:amd64=4.0.0+ds-5 Downloading dependency 139 of 328: dpkg-dev:amd64=1.22.21 Downloading dependency 140 of 328: python3-idna:amd64=3.10-1 Downloading dependency 141 of 328: libncursesw6:amd64=6.5+20250216-2 Downloading dependency 142 of 328: make:amd64=4.4.1-3 Downloading dependency 143 of 328: python3-mdit-py-plugins:amd64=0.5.0-1 Downloading dependency 144 of 328: libxdmcp6:amd64=1:1.1.5-1 Downloading dependency 145 of 328: sensible-utils:amd64=0.0.26 Downloading dependency 146 of 328: libudev1:amd64=259~rc1-1 Downloading dependency 147 of 328: libbrotli1:amd64=1.1.0-2+b7 Downloading dependency 148 of 328: ca-certificates:amd64=20250419 Downloading dependency 149 of 328: librav1e0.8:amd64=0.8.1-6 Downloading dependency 150 of 328: libfmt10:amd64=10.1.1+ds1-4 Downloading dependency 151 of 328: libxslt1.1:amd64=1.1.43-0.3 Downloading dependency 152 of 328: zlib1g:amd64=1:1.3.dfsg+really1.3.1-1+b1 Downloading dependency 153 of 328: perl:amd64=5.40.1-7 Downloading dependency 154 of 328: tar:amd64=1.35+dfsg-3.1 Downloading dependency 155 of 328: libhwasan0:amd64=15.2.0-8 Downloading dependency 156 of 328: findutils:amd64=4.10.0-3 Downloading dependency 157 of 328: libkrb5support0:amd64=1.22.1-2 Downloading dependency 158 of 328: libxau6:amd64=1:1.0.11-1 Downloading dependency 159 of 328: libyuv0:amd64=0.0.1919.20250919-1 Downloading dependency 160 of 328: cpp-x86-64-linux-gnu:amd64=4:15.2.0-4 Downloading dependency 161 of 328: python3-defusedxml:amd64=0.7.1-3 Downloading dependency 162 of 328: g++-x86-64-linux-gnu:amd64=4:15.2.0-4 Downloading dependency 163 of 328: binutils-common:amd64=2.45-8 Downloading dependency 164 of 328: libpcre2-16-0:amd64=10.46-1 Downloading dependency 165 of 328: x11-common:amd64=1:7.7+26 Downloading dependency 166 of 328: libffi8:amd64=3.5.2-2 Downloading dependency 167 of 328: libgts-0.7-5t64:amd64=0.7.6+darcs121130-5.2+b1 Downloading dependency 168 of 328: libasan8:amd64=15.2.0-8 Downloading dependency 169 of 328: libaudit1:amd64=1:4.1.2-1 Downloading dependency 170 of 328: dpkg:amd64=1.22.21 Downloading dependency 171 of 328: librhash1:amd64=1.4.6-1 Downloading dependency 172 of 328: libxml2-16:amd64=2.15.1+dfsg-0.4 Downloading dependency 173 of 328: libp11-kit0:amd64=0.25.10-1 Downloading dependency 174 of 328: liblab-gamut1:amd64=2.42.4-3 Downloading dependency 175 of 328: sgml-base:amd64=1.31+nmu1 Downloading dependency 176 of 328: python3.13:amd64=3.13.9-1 Downloading dependency 177 of 328: libfontconfig1:amd64=2.15.0-2.4 Downloading dependency 178 of 328: libisl23:amd64=0.27-1 Downloading dependency 179 of 328: libngtcp2-16:amd64=1.16.0-1 Downloading dependency 180 of 328: libpam-modules:amd64=1.7.0-5 Downloading dependency 181 of 328: libjbig0:amd64=2.1-6.1+b2 Downloading dependency 182 of 328: libnettle8t64:amd64=3.10.2-1 Downloading dependency 183 of 328: libselinux1:amd64=3.9-2 Downloading dependency 184 of 328: python3:amd64=3.13.7-1 Downloading dependency 185 of 328: libdatrie1:amd64=0.2.13-4 Downloading dependency 186 of 328: libssl3t64:amd64=3.5.4-1 Downloading dependency 187 of 328: libc-bin:amd64=2.41-12 Downloading dependency 188 of 328: libseccomp2:amd64=2.6.0-2 Downloading dependency 189 of 328: libbz2-1.0:amd64=1.0.8-6 Downloading dependency 190 of 328: libngtcp2-crypto-ossl0:amd64=1.16.0-1 Downloading dependency 191 of 328: bzip2:amd64=1.0.8-6 Downloading dependency 192 of 328: python3-markdown-it:amd64=3.0.0-3 Downloading dependency 193 of 328: libthai0:amd64=0.1.29-2+b1 Downloading dependency 194 of 328: python-babel-localedata:amd64=2.17.0-1 Downloading dependency 195 of 328: netbase:amd64=6.5 Downloading dependency 196 of 328: libdebhelper-perl:amd64=13.28 Downloading dependency 197 of 328: grep:amd64=3.12-1 Downloading dependency 198 of 328: libyaml-0-2:amd64=0.2.5-2 Downloading dependency 199 of 328: python3-breathe:amd64=4.36.0-2 Downloading dependency 200 of 328: libdav1d7:amd64=1.5.2-1 Downloading dependency 201 of 328: python3-minimal:amd64=3.13.7-1 Downloading dependency 202 of 328: libheif1:amd64=1.20.2-2+b1 Downloading dependency 203 of 328: libgcrypt20:amd64=1.11.2-3 Downloading dependency 204 of 328: libjs-jquery:amd64=3.7.1+dfsg+~3.5.33-1 Downloading dependency 205 of 328: python3-uc-micro:amd64=1.0.3-1 Downloading dependency 206 of 328: libelf1t64:amd64=0.194-1 Downloading dependency 207 of 328: python3-yaml:amd64=6.0.2-2 Downloading dependency 208 of 328: util-linux:amd64=2.41.2-4 Downloading dependency 209 of 328: libpcre2-posix3:amd64=10.46-1 Downloading dependency 210 of 328: libnghttp3-9:amd64=1.12.0-1 Downloading dependency 211 of 328: libssh2-1t64:amd64=1.11.1-1 Downloading dependency 212 of 328: python3-myst-parser:amd64=4.0.1-1 Downloading dependency 213 of 328: sysvinit-utils:amd64=3.15-6 Downloading dependency 214 of 328: libhogweed6t64:amd64=3.10.2-1 Downloading dependency 215 of 328: libgmp10:amd64=2:6.3.0+dfsg-5 Downloading dependency 216 of 328: libgav1-1:amd64=0.19.0-3+b1 Downloading dependency 217 of 328: media-types:amd64=14.0.0 Downloading dependency 218 of 328: libstdc++-15-dev:amd64=15.2.0-8 Downloading dependency 219 of 328: libcom-err2:amd64=1.47.2-3+b3 Downloading dependency 220 of 328: sphinx-common:amd64=8.2.3-9 Downloading dependency 221 of 328: libde265-0:amd64=1.0.16-1 Downloading dependency 222 of 328: libc-dev-bin:amd64=2.41-12 Downloading dependency 223 of 328: python3-exhale:amd64=0.3.7-1 Downloading dependency 224 of 328: ncurses-bin:amd64=6.5+20250216-2 Downloading dependency 225 of 328: libgnutls30t64:amd64=3.8.10-3 Downloading dependency 226 of 328: python3-charset-normalizer:amd64=3.4.3-1 Downloading dependency 227 of 328: libmagic1t64:amd64=1:5.46-5 Downloading dependency 228 of 328: libtasn1-6:amd64=4.20.0-2 Downloading dependency 229 of 328: libexpat1:amd64=2.7.3-1 Downloading dependency 230 of 328: fonts-lato:amd64=2.015-1 Downloading dependency 231 of 328: libstdc++6:amd64=15.2.0-8 Downloading dependency 232 of 328: dh-autoreconf:amd64=21 Downloading dependency 233 of 328: libarchive-zip-perl:amd64=1.68-1 Downloading dependency 234 of 328: python3-sphinx-rtd-theme:amd64=3.0.2+dfsg-3 Downloading dependency 235 of 328: libpcre2-dev:amd64=10.46-1 Downloading dependency 236 of 328: libllvm19:amd64=1:19.1.7-10.1 Downloading dependency 237 of 328: libpython3.13-minimal:amd64=3.13.9-1 Downloading dependency 238 of 328: pkgconf:amd64=1.8.1-4 Downloading dependency 239 of 328: libidn2-0:amd64=2.3.8-4 Downloading dependency 240 of 328: libctf0:amd64=2.45-8 Downloading dependency 241 of 328: fontconfig:amd64=2.15.0-2.4 Downloading dependency 242 of 328: libmpc3:amd64=1.3.1-2 Downloading dependency 243 of 328: libheif-plugin-dav1d:amd64=1.20.2-2+b1 Downloading dependency 244 of 328: libxaw7:amd64=2:1.0.16-1 Downloading dependency 245 of 328: docutils-common:amd64=0.22.3+dfsg-1 Downloading dependency 246 of 328: perl-base:amd64=5.40.1-7 Downloading dependency 247 of 328: gcc-x86-64-linux-gnu:amd64=4:15.2.0-4 Downloading dependency 248 of 328: libltdl7:amd64=2.5.4-7 Downloading dependency 249 of 328: intltool-debian:amd64=0.35.0+20060710.6 Downloading dependency 250 of 328: libglib2.0-0t64:amd64=2.86.2-1 Downloading dependency 251 of 328: libgprofng0:amd64=2.45-8 Downloading dependency 252 of 328: libgdbm6t64:amd64=1.26-1 Downloading dependency 253 of 328: xml-core:amd64=0.19 Downloading dependency 254 of 328: libpango-1.0-0:amd64=1.56.3-2 Downloading dependency 255 of 328: gettext:amd64=0.23.2-1 Downloading dependency 256 of 328: libgssapi-krb5-2:amd64=1.22.1-2 Downloading dependency 257 of 328: base-passwd:amd64=3.6.8 Downloading dependency 258 of 328: libkrb5-3:amd64=1.22.1-2 Downloading dependency 259 of 328: libnghttp2-14:amd64=1.64.0-1.1+b1 Downloading dependency 260 of 328: libsqlite3-0:amd64=3.46.1-8Get:1 http://deb.debian.org/debian unstable/main amd64 libsqlite3-0 amd64 3.46.1-8 [968 kB] Fetched 968 kB in 0s (67.1 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpx11w660v/libsqlite3-0_3.46.1-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libsasl2-modules-db amd64 2.1.28+dfsg1-10 [19.8 kB] Fetched 19.8 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmplob4y3nb/libsasl2-modules-db_2.1.28+dfsg1-10_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libfribidi0 amd64 1.0.16-3 [26.6 kB] Fetched 26.6 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp05e0z6tn/libfribidi0_1.0.16-3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libitm1 amd64 15.2.0-8 [26.5 kB] Fetched 26.5 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpn1l691v2/libitm1_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 pkgconf-bin amd64 1.8.1-4 [30.2 kB] Fetched 30.2 kB in 0s (2497 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp4c_ytuta/pkgconf-bin_1.8.1-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libjansson4 amd64 2.14-2+b3 [39.8 kB] Fetched 39.8 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpcuo6otzu/libjansson4_2.14-2+b3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libtsan2 amd64 15.2.0-8 [2491 kB] Fetched 2491 kB in 0s (79.2 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpaf4572c7/libtsan2_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 debconf all 1.5.91 [121 kB] Fetched 121 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmps5hqtrd3/debconf_1.5.91_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libcairo2 amd64 1.18.4-1+b1 [538 kB] Fetched 538 kB in 0s (37.1 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpkxj77e3q/libcairo2_1.18.4-1+b1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libdeflate0 amd64 1.23-2 [47.3 kB] Fetched 47.3 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp7y3t8he_/libdeflate0_1.23-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 openssl amd64 3.5.4-1 [1496 kB] Fetched 1496 kB in 0s (87.5 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpst3m8n86/openssl_3.5.4-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 perl-modules-5.40 all 5.40.1-7 [3012 kB] Fetched 3012 kB in 0s (121 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp8lk1vn0d/perl-modules-5.40_5.40.1-7_all.deb' Get:1 http://snapshot.debian.org/archive/debian/20251120T202450Z forky/main amd64 libtinfo6 amd64 6.5+20250216-2 [348 kB] Fetched 348 kB in 0s (29.2 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp9mnha78r/libtinfo6_6.5+20250216-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpng16-16t64 amd64 1.6.50-1 [282 kB] Fetched 282 kB in 0s (27.4 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpy_pbh5bs/libpng16-16t64_1.6.50-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libwebp7 amd64 1.5.0-0.1 [318 kB] Fetched 318 kB in 0s (27.1 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp24srmpn_/libwebp7_1.5.0-0.1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 debhelper all 13.28 [941 kB] Fetched 941 kB in 0s (63.4 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp6sdmbv7b/debhelper_13.28_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libsmartcols1 amd64 2.41.2-4 [145 kB] Fetched 145 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpt5e077c3/libsmartcols1_2.41.2-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 fonts-font-awesome all 5.0.10+really4.7.0~dfsg-4.1 [517 kB] Fetched 517 kB in 0s (41.8 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpjmgna406/fonts-font-awesome_5.0.10+really4.7.0~dfsg-4.1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libxxhash0 amd64 0.8.3-2 [27.1 kB] Fetched 27.1 kB in 0s (2694 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpox361z1k/libxxhash0_0.8.3-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 librtmp1 amd64 2.4+20151223.gitfa8646d.1-3 [58.3 kB] Fetched 58.3 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpmyqzxlxh/librtmp1_2.4+20151223.gitfa8646d.1-3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libmount1 amd64 2.41.2-4 [211 kB] Fetched 211 kB in 0s (18.0 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp24ex0xfb/libmount1_2.41.2-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 init-system-helpers all 1.69 [39.3 kB] Fetched 39.3 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpxjusqh7c/init-system-helpers_1.69_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libuchardet0 amd64 0.0.8-2 [68.5 kB] Fetched 68.5 kB in 0s (6573 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpt3dsx4bm/libuchardet0_0.0.8-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libaom3 amd64 3.13.1-2 [1906 kB] Fetched 1906 kB in 0s (90.8 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpnny0po34/libaom3_3.13.1-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libproc2-0 amd64 2:4.0.4-9 [65.6 kB] Fetched 65.6 kB in 0s (0 B/s) dpkg-name: info: moved 'libproc2-0_2%3a4.0.4-9_amd64.deb' to '/srv/rebuilderd/tmp/tmp5cupsrpk/libproc2-0_4.0.4-9_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libubsan1 amd64 15.2.0-8 [1108 kB] Fetched 1108 kB in 0s (74.3 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpiq46v2ub/libubsan1_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libeigen3-dev all 3.4.0-5 [1034 kB] Fetched 1034 kB in 0s (69.5 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpy957853z/libeigen3-dev_3.4.0-5_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libclang-cpp19 amd64 1:19.1.7-10.1 [13.2 MB] Fetched 13.2 MB in 0s (171 MB/s) dpkg-name: info: moved 'libclang-cpp19_1%3a19.1.7-10.1_amd64.deb' to '/srv/rebuilderd/tmp/tmp9sui9y0n/libclang-cpp19_19.1.7-10.1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libxext6 amd64 2:1.3.4-1+b3 [50.4 kB] Fetched 50.4 kB in 0s (0 B/s) dpkg-name: info: moved 'libxext6_2%3a1.3.4-1+b3_amd64.deb' to '/srv/rebuilderd/tmp/tmp1bzwfvgn/libxext6_1.3.4-1+b3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libmd0 amd64 1.1.0-2+b1 [36.3 kB] Fetched 36.3 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpszmsh3ki/libmd0_1.1.0-2+b1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libcap-ng0 amd64 0.8.5-4+b1 [17.6 kB] Fetched 17.6 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp9bpmy_t6/libcap-ng0_0.8.5-4+b1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libjpeg62-turbo amd64 1:2.1.5-4 [168 kB] Fetched 168 kB in 0s (16.6 MB/s) dpkg-name: info: moved 'libjpeg62-turbo_1%3a2.1.5-4_amd64.deb' to '/srv/rebuilderd/tmp/tmpruy8rkxp/libjpeg62-turbo_2.1.5-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-soupsieve all 2.7-2 [39.0 kB] Fetched 39.0 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpp3_h50a0/python3-soupsieve_2.7-2_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 bash amd64 5.3-1 [1556 kB] Fetched 1556 kB in 0s (80.3 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpw4_lxgt9/bash_5.3-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libgdbm-compat4t64 amd64 1.26-1 [52.8 kB] Fetched 52.8 kB in 0s (3866 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpovmyd6t7/libgdbm-compat4t64_1.26-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libedit2 amd64 3.1-20250104-1 [93.8 kB] Fetched 93.8 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmplxyan4tn/libedit2_3.1-20250104-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-babel all 2.17.0-1 [117 kB] Fetched 117 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp94p64fcy/python3-babel_2.17.0-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 liblsan0 amd64 15.2.0-8 [1248 kB] Fetched 1248 kB in 0s (83.6 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp4del6qqp/liblsan0_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libc6 amd64 2.41-12 [2846 kB] Fetched 2846 kB in 0s (116 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp85ic8ri2/libc6_2.41-12_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libcatch2-dev amd64 3.7.1-0.6 [646 kB] Fetched 646 kB in 0s (54.6 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpx8i3ojoe/libcatch2-dev_3.7.1-0.6_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-linkify-it all 2.0.3-1 [18.7 kB] Fetched 18.7 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpgauvslrj/python3-linkify-it_2.0.3-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 gcc-15 amd64 15.2.0-8 [527 kB] Fetched 527 kB in 0s (45.6 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpfyrgyg42/gcc-15_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libice6 amd64 2:1.1.1-1 [65.4 kB] Fetched 65.4 kB in 0s (0 B/s) dpkg-name: info: moved 'libice6_2%3a1.1.1-1_amd64.deb' to '/srv/rebuilderd/tmp/tmp3upv6zrv/libice6_1.1.1-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libgpg-error0 amd64 1.56-2 [89.1 kB] Fetched 89.1 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpjlv5ccy9/libgpg-error0_1.56-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 groff-base amd64 1.23.0-9 [1187 kB] Fetched 1187 kB in 0s (78.8 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp3d_rdwij/groff-base_1.23.0-9_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpcre2-32-0 amd64 10.46-1 [268 kB] Fetched 268 kB in 0s (25.6 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpcjt5_50l/libpcre2-32-0_10.46-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 gzip amd64 1.13-1 [138 kB] Fetched 138 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpa17hk3__/gzip_1.13-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libsm6 amd64 2:1.2.6-1 [37.3 kB] Fetched 37.3 kB in 0s (0 B/s) dpkg-name: info: moved 'libsm6_2%3a1.2.6-1_amd64.deb' to '/srv/rebuilderd/tmp/tmpdi34yy03/libsm6_1.2.6-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 autoconf all 2.72-3.1 [494 kB] Fetched 494 kB in 0s (44.7 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpj_pskbu3/autoconf_2.72-3.1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libabsl20240722 amd64 20240722.0-4 [492 kB] Fetched 492 kB in 0s (35.8 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpvk9xc_yp/libabsl20240722_20240722.0-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpsl5t64 amd64 0.21.2-1.1+b1 [57.2 kB] Fetched 57.2 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpbryhn_od/libpsl5t64_0.21.2-1.1+b1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 file amd64 1:5.46-5 [43.6 kB] Fetched 43.6 kB in 0s (0 B/s) dpkg-name: info: moved 'file_1%3a5.46-5_amd64.deb' to '/srv/rebuilderd/tmp/tmpayg6f99v/file_5.46-5_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-alabaster all 0.7.16-0.1 [27.9 kB] Fetched 27.9 kB in 0s (2610 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpwa6oto4n/python3-alabaster_0.7.16-0.1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libk5crypto3 amd64 1.22.1-2 [81.1 kB] Fetched 81.1 kB in 0s (7800 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp0ed7dn3k/libk5crypto3_1.22.1-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 debianutils amd64 5.23.2 [92.4 kB] Fetched 92.4 kB in 0s (9117 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpwem3snb0/debianutils_5.23.2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libfreetype6 amd64 2.13.3+dfsg-1 [452 kB] Fetched 452 kB in 0s (28.6 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpv8urg6q9/libfreetype6_2.13.3+dfsg-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 autopoint all 0.23.2-1 [772 kB] Fetched 772 kB in 0s (64.9 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmppsdh3146/autopoint_0.23.2-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libx11-6 amd64 2:1.8.12-1 [815 kB] Fetched 815 kB in 0s (60.5 MB/s) dpkg-name: info: moved 'libx11-6_2%3a1.8.12-1_amd64.deb' to '/srv/rebuilderd/tmp/tmpbfc8scfb/libx11-6_1.8.12-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libctf-nobfd0 amd64 2.45-8 [160 kB] Fetched 160 kB in 0s (15.9 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmptnd7rgr3/libctf-nobfd0_2.45-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libuuid1 amd64 2.41.2-4 [38.7 kB] Fetched 38.7 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmphzp2l_2i/libuuid1_2.41.2-4_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libpathplan4 amd64 2.42.4-3 [42.6 kB] Fetched 42.6 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp0had2xlj/libpathplan4_2.42.4-3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libgd3 amd64 2.3.3-13 [126 kB] Fetched 126 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpryilqnfj/libgd3_2.3.3-13_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 python3-markupsafe amd64 3.0.3-1 [13.8 kB] Fetched 13.8 kB in 0s (1340 kB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpj2wuyozl/python3-markupsafe_3.0.3-1_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libaudit-common all 1:4.1.2-1 [14.3 kB] Fetched 14.3 kB in 0s (0 B/s) dpkg-name: info: moved 'libaudit-common_1%3a4.1.2-1_all.deb' to '/srv/rebuilderd/tmp/tmph8i_9yxb/libaudit-common_4.1.2-1_all.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libatomic1 amd64 15.2.0-8 [9532 B] Fetched 9532 B in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpcozobtzu/libatomic1_15.2.0-8_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libgvpr2 amd64 2.42.4-3 [192 kB] Fetched 192 kB in 0s (19.1 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp1lzc_l2_/libgvpr2_2.42.4-3_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libperl5.40 amd64 5.40.1-7 [4317 kB] Fetched 4317 kB in 0s (135 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpsi_w7148/libperl5.40_5.40.1-7_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libuv1t64 amd64 1.51.0-2 [155 kB] Fetched 155 kB in 0s (15.3 MB/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmpigh9z172/libuv1t64_1.51.0-2_amd64.deb' Get:1 http://deb.debian.org/debian unstable/main amd64 libjsoncpp26 amd64 1.9.6-5 [82.6 kB] Fetched 82.6 kB in 0s (0 B/s) dpkg-name: warning: skipping '/srv/rebuilderd/tmp/tmp1xyetjsa/libjsoncpp26_1.9.6-5_amd64.deb' dpkg-buildpackage: info: source package debootsnap-dummy dpkg-buildpackage: info: source version 1.0 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Equivs Dummy Package Generator dpkg-buildpackage: info: host architecture amd64 dpkg-source --before-build . debian/rules clean dh clean dh_clean debian/rules binary dh binary dh_update_autotools_config dh_autoreconf create-stamp debian/debhelper-build-stamp dh_prep dh_auto_install --destdir=debian/debootsnap-dummy/ dh_install dh_installdocs dh_installchangelogs dh_perl dh_link dh_strip_nondeterminism dh_compress dh_fixperms dh_missing dh_installdeb dh_gencontrol dh_md5sums dh_builddeb dpkg-deb: building package 'debootsnap-dummy' in '../debootsnap-dummy_1.0_all.deb'. dpkg-genbuildinfo --build=binary -O../debootsnap-dummy_1.0_amd64.buildinfo dpkg-genchanges --build=binary -O../debootsnap-dummy_1.0_amd64.changes dpkg-genchanges: info: binary-only upload (no source code included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) The package has been created. Attention, the package has been created in the /srv/rebuilderd/tmp/tmp726wc24d/cache directory, not in ".." as indicated by the message above! I: automatically chosen mode: unshare I: chroot architecture amd64 is equal to the host's architecture I: using /srv/rebuilderd/tmp/mmdebstrap.WgJkrbXADX as tempdir I: running --setup-hook directly: /usr/share/mmdebstrap/hooks/maybe-merged-usr/setup00.sh /srv/rebuilderd/tmp/mmdebstrap.WgJkrbXADX 127.0.0.1 - - [21/Nov/2025 16:36:31] code 404, message File not found 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./InRelease HTTP/1.1" 404 - Ign:1 http://localhost:40201 ./ InRelease 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./Release HTTP/1.1" 200 - Get:2 http://localhost:40201 ./ Release [462 B] 127.0.0.1 - - [21/Nov/2025 16:36:31] code 404, message File not found 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./Release.gpg HTTP/1.1" 404 - Ign:3 http://localhost:40201 ./ Release.gpg 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./Packages HTTP/1.1" 200 - Get:4 http://localhost:40201 ./ Packages [402 kB] Fetched 402 kB in 0s (13.1 MB/s) Reading package lists... usr-is-merged found but not real -- not running merged-usr setup hook I: skipping apt-get update because it was already run I: downloading packages with apt... 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./gcc-15-base_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libc6_2.41-12_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libgcc-s1_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./mawk_1.3.4.20250131-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./base-files_14_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libtinfo6_6.5%2b20250216-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./debianutils_5.23.2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./bash_5.3-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libacl1_2.3.2-2%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libattr1_2.5.2-3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libcap2_2.75-10%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libgmp10_6.3.0%2bdfsg-5_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libpcre2-8-0_10.46-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libselinux1_3.9-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libzstd1_1.5.7%2bdfsg-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./zlib1g_1.3.dfsg%2breally1.3.1-1%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libssl3t64_3.5.4-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./openssl-provider-legacy_3.5.4-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libsystemd0_259%7erc1-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./coreutils_9.7-3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./dash_0.5.12-12_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./diffutils_3.12-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libbz2-1.0_1.0.8-6_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./liblzma5_5.8.1-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libmd0_1.1.0-2%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./tar_1.35%2bdfsg-3.1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./dpkg_1.22.21_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./findutils_4.10.0-3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./grep_3.12-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./gzip_1.13-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./hostname_3.25_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./ncurses-bin_6.5%2b20250216-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libcrypt1_4.5.1-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./perl-base_5.40.1-7_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./sed_4.9-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libaudit-common_4.1.2-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libcap-ng0_0.8.5-4%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libaudit1_4.1.2-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libdb5.3t64_5.3.28%2bdfsg2-10_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./debconf_1.5.91_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libpam0g_1.7.0-5_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libpam-modules-bin_1.7.0-5_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libpam-modules_1.7.0-5_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libpam-runtime_1.7.0-5_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libblkid1_2.41.2-4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libmount1_2.41.2-4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libsmartcols1_2.41.2-4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libudev1_259%7erc1-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libuuid1_2.41.2-4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./util-linux_2.41.2-4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libdebconfclient0_0.281_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./base-passwd_3.6.8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./init-system-helpers_1.69_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./libc-bin_2.41-12_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./ncurses-base_6.5%2b20250216-2_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:31] "GET /./sysvinit-utils_3.15-6_amd64.deb HTTP/1.1" 200 - I: extracting archives... I: running --extract-hook directly: /usr/share/mmdebstrap/hooks/maybe-merged-usr/extract00.sh /srv/rebuilderd/tmp/mmdebstrap.WgJkrbXADX 127.0.0.1 - - [21/Nov/2025 16:36:33] code 404, message File not found 127.0.0.1 - - [21/Nov/2025 16:36:33] "GET /./InRelease HTTP/1.1" 404 - Ign:1 http://localhost:40201 ./ InRelease 127.0.0.1 - - [21/Nov/2025 16:36:33] "GET /./Release HTTP/1.1" 304 - Hit:2 http://localhost:40201 ./ Release 127.0.0.1 - - [21/Nov/2025 16:36:33] code 404, message File not found 127.0.0.1 - - [21/Nov/2025 16:36:33] "GET /./Release.gpg HTTP/1.1" 404 - Ign:3 http://localhost:40201 ./ Release.gpg Reading package lists... usr-is-merged found but not real -- not running merged-usr extract hook I: installing essential packages... I: running --essential-hook directly: /usr/share/mmdebstrap/hooks/maybe-merged-usr/essential00.sh /srv/rebuilderd/tmp/mmdebstrap.WgJkrbXADX usr-is-merged was not installed in a previous hook -- not running merged-usr essential hook I: installing remaining packages inside the chroot... 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./fonts-lato_2.015-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libexpat1_2.7.3-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libpython3.13-minimal_3.13.9-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./python3.13-minimal_3.13.9-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./python3-minimal_3.13.7-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./media-types_14.0.0_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./netbase_6.5_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./tzdata_2025b-5_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libffi8_3.5.2-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libncursesw6_6.5%2b20250216-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./readline-common_8.3-3_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libreadline8t64_8.3-3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libsqlite3-0_3.46.1-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libpython3.13-stdlib_3.13.9-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./python3.13_3.13.9-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libpython3-stdlib_3.13.7-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./python3_3.13.7-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./sensible-utils_0.0.26_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libstdc%2b%2b6_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libuchardet0_0.0.8-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./groff-base_1.23.0-9_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./bsdextrautils_2.41.2-4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libgdbm6t64_1.26-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libpipeline1_1.5.8-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libseccomp2_2.6.0-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./man-db_2.13.1-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libproc2-0_4.0.4-9_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./procps_4.0.4-9_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./bzip2_1.0.8-6_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./openssl_3.5.4-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./ca-certificates_20250419_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libmagic-mgc_5.46-5_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libmagic1t64_5.46-5_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./file_5.46-5_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./gettext-base_0.23.2-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./perl-modules-5.40_5.40.1-7_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libgdbm-compat4t64_1.26-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libperl5.40_5.40.1-7_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./perl_5.40.1-7_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./xz-utils_5.8.1-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./m4_1.4.20-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./autoconf_2.72-3.1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./autotools-dev_20240727.1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./automake_1.18.1-3_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./autopoint_0.23.2-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libsframe2_2.45-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./binutils-common_2.45-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libbinutils_2.45-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libgprofng0_2.45-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libctf-nobfd0_2.45-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libctf0_2.45-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libjansson4_2.14-2%2bb3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./binutils-x86-64-linux-gnu_2.45-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./binutils_2.45-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libc-dev-bin_2.41-12_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./linux-libc-dev_6.17.8-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:39] "GET /./libcrypt-dev_4.5.1-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./rpcsvc-proto_1.4.3-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./libc6-dev_2.41-12_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./libisl23_0.27-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./libmpfr6_4.2.2-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./libmpc3_1.3.1-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./cpp-15-x86-64-linux-gnu_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./cpp-15_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./cpp-x86-64-linux-gnu_15.2.0-4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./cpp_15.2.0-4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./libcc1-0_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./libgomp1_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./libitm1_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./libatomic1_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./libasan8_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./liblsan0_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./libtsan2_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./libubsan1_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./libhwasan0_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./libquadmath0_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./libgcc-15-dev_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./gcc-15-x86-64-linux-gnu_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./gcc-15_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./gcc-x86-64-linux-gnu_15.2.0-4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./gcc_15.2.0-4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./libstdc%2b%2b-15-dev_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./g%2b%2b-15-x86-64-linux-gnu_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./g%2b%2b-15_15.2.0-8_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./g%2b%2b-x86-64-linux-gnu_15.2.0-4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./g%2b%2b_15.2.0-4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./make_4.4.1-3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./libdpkg-perl_1.22.21_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./patch_2.8-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./dpkg-dev_1.22.21_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./build-essential_12.12_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./libcatch2-dev_3.7.1-0.6_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./catch2_3.7.1-0.6_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./cmake-data_4.1.1%2breally3.31.6-2_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./libxxhash0_0.8.3-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./liblz4-1_1.10.0-6_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:40] "GET /./libnettle8t64_3.10.2-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libxml2-16_2.15.1%2bdfsg-0.4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libarchive13t64_3.7.4-4%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libnghttp3-9_1.12.0-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libngtcp2-16_1.16.0-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libbrotli1_1.1.0-2%2bb7_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libkrb5support0_1.22.1-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libcom-err2_1.47.2-3%2bb3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libk5crypto3_1.22.1-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libkeyutils1_1.6.3-6_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libkrb5-3_1.22.1-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libgssapi-krb5-2_1.22.1-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libunistring5_1.3-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libidn2-0_2.3.8-4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libsasl2-modules-db_2.1.28%2bdfsg1-10_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libsasl2-2_2.1.28%2bdfsg1-10_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libldap2_2.6.10%2bdfsg-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libnghttp2-14_1.64.0-1.1%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libngtcp2-crypto-ossl0_1.16.0-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libpsl5t64_0.21.2-1.1%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libhogweed6t64_3.10.2-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libp11-kit0_0.25.10-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libtasn1-6_4.20.0-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libgnutls30t64_3.8.10-3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./librtmp1_2.4%2b20151223.gitfa8646d.1-3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libssh2-1t64_1.11.1-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libcurl4t64_8.17.0-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libjsoncpp26_1.9.6-5_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./librhash1_1.4.6-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libuv1t64_1.51.0-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./cmake_4.1.1%2breally3.31.6-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libdebhelper-perl_13.28_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libtool_2.5.4-7_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./dh-autoreconf_21_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libarchive-zip-perl_1.68-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libfile-stripnondeterminism-perl_1.15.0-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./dh-strip-nondeterminism_1.15.0-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libelf1t64_0.194-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./dwz_0.16-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./gettext_0.23.2-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./intltool-debian_0.35.0%2b20060710.6_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./po-debconf_1.0.21%2bnmu1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./debhelper_13.28_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libjs-sphinxdoc_8.2.3-9_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libz3-4_4.13.3-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./python3-soupsieve_2.7-2_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./python3-typing-extensions_4.15.0-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./python3-bs4_4.14.2-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libpng16-16t64_1.6.50-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libfreetype6_2.13.3%2bdfsg-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./fonts-dejavu-mono_2.37-8_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./fonts-dejavu-core_2.37-8_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./fontconfig-config_2.15.0-2.4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libfontconfig1_2.15.0-2.4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libpixman-1-0_0.46.4-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libxau6_1.0.11-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libxdmcp6_1.1.5-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libxcb1_1.17.0-2%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libx11-data_1.8.12-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libx11-6_1.8.12-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libxcb-render0_1.17.0-2%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libxcb-shm0_1.17.0-2%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libxext6_1.3.4-1%2bb3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libxrender1_0.9.12-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libcairo2_1.18.4-1%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libcdt5_2.42.4-3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libcgraph6_2.42.4-3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libaom3_3.13.1-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libdav1d7_1.5.2-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libabsl20240722_20240722.0-4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libgav1-1_0.19.0-3%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./librav1e0.8_0.8.1-6_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libsvtav1enc2_2.3.0%2bdfsg-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libjpeg62-turbo_2.1.5-4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libyuv0_0.0.1919.20250919-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libavif16_1.3.0-1%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libsharpyuv0_1.5.0-0.1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libheif-plugin-dav1d_1.20.2-2%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libde265-0_1.0.16-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libheif-plugin-libde265_1.20.2-2%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libheif1_1.20.2-2%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libimagequant0_4.4.0-3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libdeflate0_1.23-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libjbig0_2.1-6.1%2bb2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./liblerc4_4.0.0%2bds-5_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libwebp7_1.5.0-0.1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libtiff6_4.7.1-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libxpm4_3.5.17-1%2bb3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:41] "GET /./libgd3_2.3.3-13_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libglib2.0-0t64_2.86.2-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libgts-0.7-5t64_0.7.6%2bdarcs121130-5.2%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libltdl7_2.5.4-7_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./fontconfig_2.15.0-2.4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libfribidi0_1.0.16-3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libgraphite2-3_1.3.14-11_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libharfbuzz0b_12.1.0-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libthai-data_0.1.29-2_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libdatrie1_0.2.13-4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libthai0_0.1.29-2%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libpango-1.0-0_1.56.3-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libpangoft2-1.0-0_1.56.3-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libpangocairo-1.0-0_1.56.3-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libpathplan4_2.42.4-3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libgvc6_2.42.4-3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libpkgconf3_1.8.1-4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-markupsafe_3.0.3-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-jinja2_3.1.6-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-urllib3_2.5.0-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-snowballstemmer_3.0.1-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libgpg-error0_1.56-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libgcrypt20_1.11.2-3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libxslt1.1_1.1.43-0.3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-lxml_6.0.2-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libann0_1.1.2%2bdoc-9%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libxapian30_1.4.29-3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libbsd0_0.12.2-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libjs-jquery_3.7.1%2bdfsg%2b%7e3.5.33-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-defusedxml_0.7.1-3_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libjson-perl_4.10000-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./sphinx-common_8.2.3-9_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-alabaster_0.7.16-0.1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python-babel-localedata_2.17.0-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-babel_2.17.0-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./sgml-base_1.31%2bnmu1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./xml-core_0.19_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./docutils-common_0.22.3%2bdfsg-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-roman-numerals_3.1.0-2_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-docutils_0.22.3%2bdfsg-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-imagesize_1.4.1-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-packaging_25.0-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-pygments_2.18.0%2bdfsg-2_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-certifi_2025.1.31%2bds-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-charset-normalizer_3.4.3-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-idna_3.10-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-chardet_5.2.0%2bdfsg-2_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-requests_2.32.5%2bdfsg-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-sphinx_8.2.3-9_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-sphinxcontrib.jquery_4.1-6_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./fonts-font-awesome_5.0.10%2breally4.7.0%7edfsg-4.1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./sphinx-rtd-theme-common_3.0.2%2bdfsg-3_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libgvpr2_2.42.4-3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./liblab-gamut1_2.42.4-3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./x11-common_7.7%2b26_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libice6_1.1.1-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libsm6_1.2.6-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libxt6t64_1.2.1-1.3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libxmu6_1.1.3-3%2bb4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libxaw7_1.0.16-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./graphviz_2.42.4-3_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libedit2_3.1-20250104-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libllvm19_19.1.7-10.1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libclang-cpp19_19.1.7-10.1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libclang1-19_19.1.7-10.1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libfmt10_10.1.1%2bds1-4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./doxygen_1.9.8%2bds-2.1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./zlib1g-dev_1.3.dfsg%2breally1.3.1-1%2bb1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-six_1.17.0-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-mdurl_0.1.2-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./pkgconf-bin_1.8.1-4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./pkgconf_1.8.1-4_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-uc-micro_1.0.3-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-linkify-it_2.0.3-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-markdown-it_3.0.0-3_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-mdit-py-plugins_0.5.0-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libpcre2-16-0_10.46-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libyaml-0-2_0.2.5-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-breathe_4.36.0-2_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-yaml_6.0.2-2_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libpcre2-posix3_10.46-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-myst-parser_4.0.1-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-exhale_0.3.7-1_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./python3-sphinx-rtd-theme_3.0.2%2bdfsg-3_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libpcre2-32-0_10.46-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libpcre2-dev_10.46-1_amd64.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./libeigen3-dev_3.4.0-5_all.deb HTTP/1.1" 200 - 127.0.0.1 - - [21/Nov/2025 16:36:42] "GET /./debootsnap-dummy_1.0_all.deb HTTP/1.1" 200 - I: running --customize-hook directly: /srv/rebuilderd/tmp/tmp726wc24d/apt_install.sh /srv/rebuilderd/tmp/mmdebstrap.WgJkrbXADX Reading package lists... Building dependency tree... Reading state information... dash is already the newest version (0.5.12-12). libjs-sphinxdoc is already the newest version (8.2.3-9). libjs-sphinxdoc set to manually installed. libpam-runtime is already the newest version (1.7.0-5). xz-utils is already the newest version (5.8.1-2). xz-utils set to manually installed. libarchive13t64 is already the newest version (3.7.4-4+b1). libarchive13t64 set to manually installed. g++-15-x86-64-linux-gnu is already the newest version (15.2.0-8). g++-15-x86-64-linux-gnu set to manually installed. libz3-4 is already the newest version (4.13.3-1). libz3-4 set to manually installed. binutils is already the newest version (2.45-8). binutils set to manually installed. libmpfr6 is already the newest version (4.2.2-2). libmpfr6 set to manually installed. libtool is already the newest version (2.5.4-7). libtool set to manually installed. po-debconf is already the newest version (1.0.21+nmu1). po-debconf set to manually installed. python3-bs4 is already the newest version (4.14.2-1). python3-bs4 set to manually installed. libgvc6 is already the newest version (2.42.4-3). libgvc6 set to manually installed. cmake is already the newest version (4.1.1+really3.31.6-2). cmake set to manually installed. libcrypt-dev is already the newest version (1:4.5.1-1). libcrypt-dev set to manually installed. libpkgconf3 is already the newest version (1.8.1-4). libpkgconf3 set to manually installed. libblkid1 is already the newest version (2.41.2-4). base-files is already the newest version (14). libbinutils is already the newest version (2.45-8). libbinutils set to manually installed. g++-15 is already the newest version (15.2.0-8). g++-15 set to manually installed. python3-jinja2 is already the newest version (3.1.6-1). python3-jinja2 set to manually installed. python3-urllib3 is already the newest version (2.5.0-1). python3-urllib3 set to manually installed. libcrypt1 is already the newest version (1:4.5.1-1). automake is already the newest version (1:1.18.1-3). automake set to manually installed. python3-snowballstemmer is already the newest version (3.0.1-1). python3-snowballstemmer set to manually installed. libdebconfclient0 is already the newest version (0.281). gettext-base is already the newest version (0.23.2-1). gettext-base set to manually installed. python3-lxml is already the newest version (6.0.2-1). python3-lxml set to manually installed. dwz is already the newest version (0.16-2). dwz set to manually installed. tzdata is already the newest version (2025b-5). tzdata set to manually installed. libgraphite2-3 is already the newest version (1.3.14-11). libgraphite2-3 set to manually installed. g++ is already the newest version (4:15.2.0-4). g++ set to manually installed. fonts-dejavu-core is already the newest version (2.37-8). fonts-dejavu-core set to manually installed. cpp is already the newest version (4:15.2.0-4). cpp set to manually installed. cpp-15 is already the newest version (15.2.0-8). cpp-15 set to manually installed. libann0 is already the newest version (1.1.2+doc-9+b1). libann0 set to manually installed. libxapian30 is already the newest version (1.4.29-3). libxapian30 set to manually installed. libcurl4t64 is already the newest version (8.17.0-2). libcurl4t64 set to manually installed. libheif-plugin-libde265 is already the newest version (1.20.2-2+b1). libheif-plugin-libde265 set to manually installed. gcc is already the newest version (4:15.2.0-4). gcc set to manually installed. liblz4-1 is already the newest version (1.10.0-6). liblz4-1 set to manually installed. libbsd0 is already the newest version (0.12.2-2). libbsd0 set to manually installed. python3-sphinxcontrib.jquery is already the newest version (4.1-6). python3-sphinxcontrib.jquery set to manually installed. libreadline8t64 is already the newest version (8.3-3). libreadline8t64 set to manually installed. libxcb1 is already the newest version (1.17.0-2+b1). libxcb1 set to manually installed. procps is already the newest version (2:4.0.4-9). procps set to manually installed. binutils-x86-64-linux-gnu is already the newest version (2.45-8). binutils-x86-64-linux-gnu set to manually installed. libmagic-mgc is already the newest version (1:5.46-5). libmagic-mgc set to manually installed. libpcre2-8-0 is already the newest version (10.46-1). ncurses-base is already the newest version (6.5+20250216-2). sphinx-rtd-theme-common is already the newest version (3.0.2+dfsg-3). sphinx-rtd-theme-common set to manually installed. sed is already the newest version (4.9-2). libcdt5 is already the newest version (2.42.4-3). libcdt5 set to manually installed. gcc-15-base is already the newest version (15.2.0-8). python3-sphinx is already the newest version (8.2.3-9). python3-sphinx set to manually installed. libpam0g is already the newest version (1.7.0-5). readline-common is already the newest version (8.3-3). readline-common set to manually installed. libpangoft2-1.0-0 is already the newest version (1.56.3-2). libpangoft2-1.0-0 set to manually installed. graphviz is already the newest version (2.42.4-3). graphviz set to manually installed. doxygen is already the newest version (1.9.8+ds-2.1). doxygen set to manually installed. python3-docutils is already the newest version (0.22.3+dfsg-1). python3-docutils set to manually installed. libavif16 is already the newest version (1.3.0-1+b1). libavif16 set to manually installed. man-db is already the newest version (2.13.1-1). man-db set to manually installed. fontconfig-config is already the newest version (2.15.0-2.4). fontconfig-config set to manually installed. cpp-15-x86-64-linux-gnu is already the newest version (15.2.0-8). cpp-15-x86-64-linux-gnu set to manually installed. python3-requests is already the newest version (2.32.5+dfsg-1). python3-requests set to manually installed. libpython3-stdlib is already the newest version (3.13.7-1). libpython3-stdlib set to manually installed. bsdextrautils is already the newest version (2.41.2-4). bsdextrautils set to manually installed. libunistring5 is already the newest version (1.3-2). libunistring5 set to manually installed. libgomp1 is already the newest version (15.2.0-8). libgomp1 set to manually installed. m4 is already the newest version (1.4.20-2). m4 set to manually installed. python3-roman-numerals is already the newest version (3.1.0-2). python3-roman-numerals set to manually installed. diffutils is already the newest version (1:3.12-1). build-essential is already the newest version (12.12). build-essential set to manually installed. libx11-data is already the newest version (2:1.8.12-1). libx11-data set to manually installed. cmake-data is already the newest version (4.1.1+really3.31.6-2). cmake-data set to manually installed. dh-strip-nondeterminism is already the newest version (1.15.0-1). dh-strip-nondeterminism set to manually installed. libldap2 is already the newest version (2.6.10+dfsg-1). libldap2 set to manually installed. zlib1g-dev is already the newest version (1:1.3.dfsg+really1.3.1-1+b1). zlib1g-dev set to manually installed. libpixman-1-0 is already the newest version (0.46.4-1). libpixman-1-0 set to manually installed. python3-typing-extensions is already the newest version (4.15.0-1). python3-typing-extensions set to manually installed. libsvtav1enc2 is already the newest version (2.3.0+dfsg-1). libsvtav1enc2 set to manually installed. python3-certifi is already the newest version (2025.1.31+ds-1). python3-certifi set to manually installed. libcgraph6 is already the newest version (2.42.4-3). libcgraph6 set to manually installed. rpcsvc-proto is already the newest version (1.4.3-1). rpcsvc-proto set to manually installed. liblzma5 is already the newest version (5.8.1-2). libxpm4 is already the newest version (1:3.5.17-1+b3). libxpm4 set to manually installed. libxrender1 is already the newest version (1:0.9.12-1). libxrender1 set to manually installed. catch2 is already the newest version (3.7.1-0.6). catch2 set to manually installed. gcc-15-x86-64-linux-gnu is already the newest version (15.2.0-8). gcc-15-x86-64-linux-gnu set to manually installed. libxcb-render0 is already the newest version (1.17.0-2+b1). libxcb-render0 set to manually installed. python3.13-minimal is already the newest version (3.13.9-1). python3.13-minimal set to manually installed. libsasl2-2 is already the newest version (2.1.28+dfsg1-10). libsasl2-2 set to manually installed. libpython3.13-stdlib is already the newest version (3.13.9-1). libpython3.13-stdlib set to manually installed. libpam-modules-bin is already the newest version (1.7.0-5). libxmu6 is already the newest version (2:1.1.3-3+b4). libxmu6 set to manually installed. libgcc-s1 is already the newest version (15.2.0-8). python3-six is already the newest version (1.17.0-1). python3-six set to manually installed. mawk is already the newest version (1.3.4.20250131-1). autotools-dev is already the newest version (20240727.1). autotools-dev set to manually installed. libxt6t64 is already the newest version (1:1.2.1-1.3). libxt6t64 set to manually installed. libjson-perl is already the newest version (4.10000-1). libjson-perl set to manually installed. libzstd1 is already the newest version (1.5.7+dfsg-2). libpangocairo-1.0-0 is already the newest version (1.56.3-2). libpangocairo-1.0-0 set to manually installed. libpipeline1 is already the newest version (1.5.8-1). libpipeline1 set to manually installed. libattr1 is already the newest version (1:2.5.2-3). python3-imagesize is already the newest version (1.4.1-1). python3-imagesize set to manually installed. libdpkg-perl is already the newest version (1.22.21). libdpkg-perl set to manually installed. libc6-dev is already the newest version (2.41-12). libc6-dev set to manually installed. libgcc-15-dev is already the newest version (15.2.0-8). libgcc-15-dev set to manually installed. libcap2 is already the newest version (1:2.75-10+b1). libcc1-0 is already the newest version (15.2.0-8). libcc1-0 set to manually installed. python3-chardet is already the newest version (5.2.0+dfsg-2). python3-chardet set to manually installed. fonts-dejavu-mono is already the newest version (2.37-8). fonts-dejavu-mono set to manually installed. patch is already the newest version (2.8-2). patch set to manually installed. libsharpyuv0 is already the newest version (1.5.0-0.1). libsharpyuv0 set to manually installed. python3-mdurl is already the newest version (0.1.2-1). python3-mdurl set to manually installed. libtiff6 is already the newest version (4.7.1-1). libtiff6 set to manually installed. hostname is already the newest version (3.25). linux-libc-dev is already the newest version (6.17.8-1). linux-libc-dev set to manually installed. openssl-provider-legacy is already the newest version (3.5.4-1). libacl1 is already the newest version (2.3.2-2+b1). libclang1-19 is already the newest version (1:19.1.7-10.1). libclang1-19 set to manually installed. coreutils is already the newest version (9.7-3). libsystemd0 is already the newest version (259~rc1-1). libharfbuzz0b is already the newest version (12.1.0-1). libharfbuzz0b set to manually installed. libkeyutils1 is already the newest version (1.6.3-6). libkeyutils1 set to manually installed. libquadmath0 is already the newest version (15.2.0-8). libquadmath0 set to manually installed. libxcb-shm0 is already the newest version (1.17.0-2+b1). libxcb-shm0 set to manually installed. libthai-data is already the newest version (0.1.29-2). libthai-data set to manually installed. libimagequant0 is already the newest version (4.4.0-3). libimagequant0 set to manually installed. python3-packaging is already the newest version (25.0-1). python3-packaging set to manually installed. libdb5.3t64 is already the newest version (5.3.28+dfsg2-10). libfile-stripnondeterminism-perl is already the newest version (1.15.0-1). libfile-stripnondeterminism-perl set to manually installed. libsframe2 is already the newest version (2.45-8). libsframe2 set to manually installed. python3-pygments is already the newest version (2.18.0+dfsg-2). python3-pygments set to manually installed. liblerc4 is already the newest version (4.0.0+ds-5). liblerc4 set to manually installed. dpkg-dev is already the newest version (1.22.21). dpkg-dev set to manually installed. python3-idna is already the newest version (3.10-1). python3-idna set to manually installed. libncursesw6 is already the newest version (6.5+20250216-2). libncursesw6 set to manually installed. make is already the newest version (4.4.1-3). make set to manually installed. python3-mdit-py-plugins is already the newest version (0.5.0-1). python3-mdit-py-plugins set to manually installed. libxdmcp6 is already the newest version (1:1.1.5-1). libxdmcp6 set to manually installed. sensible-utils is already the newest version (0.0.26). sensible-utils set to manually installed. libudev1 is already the newest version (259~rc1-1). libbrotli1 is already the newest version (1.1.0-2+b7). libbrotli1 set to manually installed. ca-certificates is already the newest version (20250419). ca-certificates set to manually installed. librav1e0.8 is already the newest version (0.8.1-6). librav1e0.8 set to manually installed. libfmt10 is already the newest version (10.1.1+ds1-4). libfmt10 set to manually installed. libxslt1.1 is already the newest version (1.1.43-0.3). libxslt1.1 set to manually installed. zlib1g is already the newest version (1:1.3.dfsg+really1.3.1-1+b1). perl is already the newest version (5.40.1-7). perl set to manually installed. tar is already the newest version (1.35+dfsg-3.1). libhwasan0 is already the newest version (15.2.0-8). libhwasan0 set to manually installed. findutils is already the newest version (4.10.0-3). libkrb5support0 is already the newest version (1.22.1-2). libkrb5support0 set to manually installed. libxau6 is already the newest version (1:1.0.11-1). libxau6 set to manually installed. libyuv0 is already the newest version (0.0.1919.20250919-1). libyuv0 set to manually installed. cpp-x86-64-linux-gnu is already the newest version (4:15.2.0-4). cpp-x86-64-linux-gnu set to manually installed. python3-defusedxml is already the newest version (0.7.1-3). python3-defusedxml set to manually installed. g++-x86-64-linux-gnu is already the newest version (4:15.2.0-4). g++-x86-64-linux-gnu set to manually installed. binutils-common is already the newest version (2.45-8). binutils-common set to manually installed. libpcre2-16-0 is already the newest version (10.46-1). libpcre2-16-0 set to manually installed. x11-common is already the newest version (1:7.7+26). x11-common set to manually installed. libffi8 is already the newest version (3.5.2-2). libffi8 set to manually installed. libgts-0.7-5t64 is already the newest version (0.7.6+darcs121130-5.2+b1). libgts-0.7-5t64 set to manually installed. libasan8 is already the newest version (15.2.0-8). libasan8 set to manually installed. libaudit1 is already the newest version (1:4.1.2-1). dpkg is already the newest version (1.22.21). librhash1 is already the newest version (1.4.6-1). librhash1 set to manually installed. libxml2-16 is already the newest version (2.15.1+dfsg-0.4). libxml2-16 set to manually installed. libp11-kit0 is already the newest version (0.25.10-1). libp11-kit0 set to manually installed. liblab-gamut1 is already the newest version (2.42.4-3). liblab-gamut1 set to manually installed. sgml-base is already the newest version (1.31+nmu1). sgml-base set to manually installed. python3.13 is already the newest version (3.13.9-1). python3.13 set to manually installed. libfontconfig1 is already the newest version (2.15.0-2.4). libfontconfig1 set to manually installed. libisl23 is already the newest version (0.27-1). libisl23 set to manually installed. libngtcp2-16 is already the newest version (1.16.0-1). libngtcp2-16 set to manually installed. libpam-modules is already the newest version (1.7.0-5). libjbig0 is already the newest version (2.1-6.1+b2). libjbig0 set to manually installed. libnettle8t64 is already the newest version (3.10.2-1). libnettle8t64 set to manually installed. libselinux1 is already the newest version (3.9-2). python3 is already the newest version (3.13.7-1). python3 set to manually installed. libdatrie1 is already the newest version (0.2.13-4). libdatrie1 set to manually installed. libssl3t64 is already the newest version (3.5.4-1). libc-bin is already the newest version (2.41-12). libseccomp2 is already the newest version (2.6.0-2). libseccomp2 set to manually installed. libbz2-1.0 is already the newest version (1.0.8-6). libngtcp2-crypto-ossl0 is already the newest version (1.16.0-1). libngtcp2-crypto-ossl0 set to manually installed. bzip2 is already the newest version (1.0.8-6). bzip2 set to manually installed. python3-markdown-it is already the newest version (3.0.0-3). python3-markdown-it set to manually installed. libthai0 is already the newest version (0.1.29-2+b1). libthai0 set to manually installed. python-babel-localedata is already the newest version (2.17.0-1). python-babel-localedata set to manually installed. netbase is already the newest version (6.5). netbase set to manually installed. libdebhelper-perl is already the newest version (13.28). libdebhelper-perl set to manually installed. grep is already the newest version (3.12-1). libyaml-0-2 is already the newest version (0.2.5-2). libyaml-0-2 set to manually installed. python3-breathe is already the newest version (4.36.0-2). python3-breathe set to manually installed. libdav1d7 is already the newest version (1.5.2-1). libdav1d7 set to manually installed. python3-minimal is already the newest version (3.13.7-1). python3-minimal set to manually installed. libheif1 is already the newest version (1.20.2-2+b1). libheif1 set to manually installed. libgcrypt20 is already the newest version (1.11.2-3). libgcrypt20 set to manually installed. libjs-jquery is already the newest version (3.7.1+dfsg+~3.5.33-1). libjs-jquery set to manually installed. python3-uc-micro is already the newest version (1.0.3-1). python3-uc-micro set to manually installed. libelf1t64 is already the newest version (0.194-1). libelf1t64 set to manually installed. python3-yaml is already the newest version (6.0.2-2). python3-yaml set to manually installed. util-linux is already the newest version (2.41.2-4). libpcre2-posix3 is already the newest version (10.46-1). libpcre2-posix3 set to manually installed. libnghttp3-9 is already the newest version (1.12.0-1). libnghttp3-9 set to manually installed. libssh2-1t64 is already the newest version (1.11.1-1). libssh2-1t64 set to manually installed. python3-myst-parser is already the newest version (4.0.1-1). python3-myst-parser set to manually installed. sysvinit-utils is already the newest version (3.15-6). libhogweed6t64 is already the newest version (3.10.2-1). libhogweed6t64 set to manually installed. libgmp10 is already the newest version (2:6.3.0+dfsg-5). libgav1-1 is already the newest version (0.19.0-3+b1). libgav1-1 set to manually installed. media-types is already the newest version (14.0.0). media-types set to manually installed. libstdc++-15-dev is already the newest version (15.2.0-8). libstdc++-15-dev set to manually installed. libcom-err2 is already the newest version (1.47.2-3+b3). libcom-err2 set to manually installed. sphinx-common is already the newest version (8.2.3-9). sphinx-common set to manually installed. libde265-0 is already the newest version (1.0.16-1). libde265-0 set to manually installed. libc-dev-bin is already the newest version (2.41-12). libc-dev-bin set to manually installed. python3-exhale is already the newest version (0.3.7-1). python3-exhale set to manually installed. ncurses-bin is already the newest version (6.5+20250216-2). libgnutls30t64 is already the newest version (3.8.10-3). libgnutls30t64 set to manually installed. python3-charset-normalizer is already the newest version (3.4.3-1). python3-charset-normalizer set to manually installed. libmagic1t64 is already the newest version (1:5.46-5). libmagic1t64 set to manually installed. libtasn1-6 is already the newest version (4.20.0-2). libtasn1-6 set to manually installed. libexpat1 is already the newest version (2.7.3-1). libexpat1 set to manually installed. fonts-lato is already the newest version (2.015-1). fonts-lato set to manually installed. libstdc++6 is already the newest version (15.2.0-8). libstdc++6 set to manually installed. dh-autoreconf is already the newest version (21). dh-autoreconf set to manually installed. libarchive-zip-perl is already the newest version (1.68-1). libarchive-zip-perl set to manually installed. python3-sphinx-rtd-theme is already the newest version (3.0.2+dfsg-3). python3-sphinx-rtd-theme set to manually installed. libpcre2-dev is already the newest version (10.46-1). libpcre2-dev set to manually installed. libllvm19 is already the newest version (1:19.1.7-10.1). libllvm19 set to manually installed. libpython3.13-minimal is already the newest version (3.13.9-1). libpython3.13-minimal set to manually installed. pkgconf is already the newest version (1.8.1-4). pkgconf set to manually installed. libidn2-0 is already the newest version (2.3.8-4). libidn2-0 set to manually installed. libctf0 is already the newest version (2.45-8). libctf0 set to manually installed. fontconfig is already the newest version (2.15.0-2.4). fontconfig set to manually installed. libmpc3 is already the newest version (1.3.1-2). libmpc3 set to manually installed. libheif-plugin-dav1d is already the newest version (1.20.2-2+b1). libheif-plugin-dav1d set to manually installed. libxaw7 is already the newest version (2:1.0.16-1). libxaw7 set to manually installed. docutils-common is already the newest version (0.22.3+dfsg-1). docutils-common set to manually installed. perl-base is already the newest version (5.40.1-7). gcc-x86-64-linux-gnu is already the newest version (4:15.2.0-4). gcc-x86-64-linux-gnu set to manually installed. libltdl7 is already the newest version (2.5.4-7). libltdl7 set to manually installed. intltool-debian is already the newest version (0.35.0+20060710.6). intltool-debian set to manually installed. libglib2.0-0t64 is already the newest version (2.86.2-1). libglib2.0-0t64 set to manually installed. libgprofng0 is already the newest version (2.45-8). libgprofng0 set to manually installed. libgdbm6t64 is already the newest version (1.26-1). libgdbm6t64 set to manually installed. xml-core is already the newest version (0.19). xml-core set to manually installed. libpango-1.0-0 is already the newest version (1.56.3-2). libpango-1.0-0 set to manually installed. gettext is already the newest version (0.23.2-1). gettext set to manually installed. libgssapi-krb5-2 is already the newest version (1.22.1-2). libgssapi-krb5-2 set to manually installed. base-passwd is already the newest version (3.6.8). libkrb5-3 is already the newest version (1.22.1-2). libkrb5-3 set to manually installed. libnghttp2-14 is already the newest version (1.64.0-1.1+b1). libnghttp2-14 set to manually installed. libsqlite3-0 is already the newest version (3.46.1-8). libsqlite3-0 set to manually installed. libsasl2-modules-db is already the newest version (2.1.28+dfsg1-10). libsasl2-modules-db set to manually installed. libfribidi0 is already the newest version (1.0.16-3). libfribidi0 set to manually installed. libitm1 is already the newest version (15.2.0-8). libitm1 set to manually installed. pkgconf-bin is already the newest version (1.8.1-4). pkgconf-bin set to manually installed. libjansson4 is already the newest version (2.14-2+b3). libjansson4 set to manually installed. libtsan2 is already the newest version (15.2.0-8). libtsan2 set to manually installed. debconf is already the newest version (1.5.91). libcairo2 is already the newest version (1.18.4-1+b1). libcairo2 set to manually installed. libdeflate0 is already the newest version (1.23-2). libdeflate0 set to manually installed. openssl is already the newest version (3.5.4-1). openssl set to manually installed. perl-modules-5.40 is already the newest version (5.40.1-7). perl-modules-5.40 set to manually installed. libtinfo6 is already the newest version (6.5+20250216-2). libpng16-16t64 is already the newest version (1.6.50-1). libpng16-16t64 set to manually installed. libwebp7 is already the newest version (1.5.0-0.1). libwebp7 set to manually installed. debhelper is already the newest version (13.28). debhelper set to manually installed. libsmartcols1 is already the newest version (2.41.2-4). fonts-font-awesome is already the newest version (5.0.10+really4.7.0~dfsg-4.1). fonts-font-awesome set to manually installed. libxxhash0 is already the newest version (0.8.3-2). libxxhash0 set to manually installed. librtmp1 is already the newest version (2.4+20151223.gitfa8646d.1-3). librtmp1 set to manually installed. libmount1 is already the newest version (2.41.2-4). init-system-helpers is already the newest version (1.69). libuchardet0 is already the newest version (0.0.8-2). libuchardet0 set to manually installed. libaom3 is already the newest version (3.13.1-2). libaom3 set to manually installed. libproc2-0 is already the newest version (2:4.0.4-9). libproc2-0 set to manually installed. libubsan1 is already the newest version (15.2.0-8). libubsan1 set to manually installed. libeigen3-dev is already the newest version (3.4.0-5). libeigen3-dev set to manually installed. libclang-cpp19 is already the newest version (1:19.1.7-10.1). libclang-cpp19 set to manually installed. libxext6 is already the newest version (2:1.3.4-1+b3). libxext6 set to manually installed. libmd0 is already the newest version (1.1.0-2+b1). libcap-ng0 is already the newest version (0.8.5-4+b1). libjpeg62-turbo is already the newest version (1:2.1.5-4). libjpeg62-turbo set to manually installed. python3-soupsieve is already the newest version (2.7-2). python3-soupsieve set to manually installed. bash is already the newest version (5.3-1). libgdbm-compat4t64 is already the newest version (1.26-1). libgdbm-compat4t64 set to manually installed. libedit2 is already the newest version (3.1-20250104-1). libedit2 set to manually installed. python3-babel is already the newest version (2.17.0-1). python3-babel set to manually installed. liblsan0 is already the newest version (15.2.0-8). liblsan0 set to manually installed. libc6 is already the newest version (2.41-12). libcatch2-dev is already the newest version (3.7.1-0.6). libcatch2-dev set to manually installed. python3-linkify-it is already the newest version (2.0.3-1). python3-linkify-it set to manually installed. gcc-15 is already the newest version (15.2.0-8). gcc-15 set to manually installed. libice6 is already the newest version (2:1.1.1-1). libice6 set to manually installed. libgpg-error0 is already the newest version (1.56-2). libgpg-error0 set to manually installed. groff-base is already the newest version (1.23.0-9). groff-base set to manually installed. libpcre2-32-0 is already the newest version (10.46-1). libpcre2-32-0 set to manually installed. gzip is already the newest version (1.13-1). libsm6 is already the newest version (2:1.2.6-1). libsm6 set to manually installed. autoconf is already the newest version (2.72-3.1). autoconf set to manually installed. libabsl20240722 is already the newest version (20240722.0-4). libabsl20240722 set to manually installed. libpsl5t64 is already the newest version (0.21.2-1.1+b1). libpsl5t64 set to manually installed. file is already the newest version (1:5.46-5). file set to manually installed. python3-alabaster is already the newest version (0.7.16-0.1). python3-alabaster set to manually installed. libk5crypto3 is already the newest version (1.22.1-2). libk5crypto3 set to manually installed. debianutils is already the newest version (5.23.2). libfreetype6 is already the newest version (2.13.3+dfsg-1). libfreetype6 set to manually installed. autopoint is already the newest version (0.23.2-1). autopoint set to manually installed. libx11-6 is already the newest version (2:1.8.12-1). libx11-6 set to manually installed. libctf-nobfd0 is already the newest version (2.45-8). libctf-nobfd0 set to manually installed. libuuid1 is already the newest version (2.41.2-4). libpathplan4 is already the newest version (2.42.4-3). libpathplan4 set to manually installed. libgd3 is already the newest version (2.3.3-13). libgd3 set to manually installed. python3-markupsafe is already the newest version (3.0.3-1). python3-markupsafe set to manually installed. libaudit-common is already the newest version (1:4.1.2-1). libatomic1 is already the newest version (15.2.0-8). libatomic1 set to manually installed. libgvpr2 is already the newest version (2.42.4-3). libgvpr2 set to manually installed. libperl5.40 is already the newest version (5.40.1-7). libperl5.40 set to manually installed. libuv1t64 is already the newest version (1.51.0-2). libuv1t64 set to manually installed. libjsoncpp26 is already the newest version (1.9.6-5). libjsoncpp26 set to manually installed. The following NEW packages will be installed: pkg-config 127.0.0.1 - - [21/Nov/2025 16:37:34] "GET /./pkg-config_1.8.1-4_amd64.deb HTTP/1.1" 200 - 0 upgraded, 1 newly installed, 0 to remove and 0 not upgraded. Need to get 14.0 kB of archives. After this operation, 29.7 kB of additional disk space will be used. Get:1 http://localhost:40201 ./ pkg-config 1.8.1-4 [14.0 kB] Fetched 14.0 kB in 0s (631 kB/s) Chrooting into /srv/rebuilderd/tmp/mmdebstrap.WgJkrbXADX/ Selecting previously unselected package pkg-config:amd64. (Reading database ... (Reading database ... 5% (Reading database ... 10% (Reading database ... 15% (Reading database ... 20% (Reading database ... 25% (Reading database ... 30% (Reading database ... 35% (Reading database ... 40% (Reading database ... 45% (Reading database ... 50% (Reading database ... 55% (Reading database ... 60% (Reading database ... 65% (Reading database ... 70% (Reading database ... 75% (Reading database ... 80% (Reading database ... 85% (Reading database ... 90% (Reading database ... 95% (Reading database ... 100% (Reading database ... 25899 files and directories currently installed.) Preparing to unpack .../pkg-config_1.8.1-4_amd64.deb ... Unpacking pkg-config:amd64 (1.8.1-4) ... Chrooting into /srv/rebuilderd/tmp/mmdebstrap.WgJkrbXADX/ Setting up pkg-config:amd64 (1.8.1-4) ... I: running --customize-hook in shell: sh -c 'chroot "$1" dpkg -r debootsnap-dummy' exec /srv/rebuilderd/tmp/mmdebstrap.WgJkrbXADX (Reading database ... 25904 files and directories currently installed.) Removing debootsnap-dummy (1.0) ... I: running --customize-hook in shell: sh -c 'chroot "$1" dpkg-query --showformat '${binary:Package}=${Version}\n' --show > "$1/pkglist"' exec /srv/rebuilderd/tmp/mmdebstrap.WgJkrbXADX I: running special hook: download /pkglist ./pkglist I: running --customize-hook in shell: sh -c 'rm "$1/pkglist"' exec /srv/rebuilderd/tmp/mmdebstrap.WgJkrbXADX I: running special hook: upload sources.list /etc/apt/sources.list I: waiting for background processes to finish... I: cleaning package lists and apt cache... I: skipping cleanup/reproducible as requested I: creating tarball... I: done I: removing tempdir /srv/rebuilderd/tmp/mmdebstrap.WgJkrbXADX... I: success in 86.3239 seconds Downloading dependency 261 of 328: libsasl2-modules-db:amd64=2.1.28+dfsg1-10 Downloading dependency 262 of 328: libfribidi0:amd64=1.0.16-3 Downloading dependency 263 of 328: libitm1:amd64=15.2.0-8 Downloading dependency 264 of 328: pkgconf-bin:amd64=1.8.1-4 Downloading dependency 265 of 328: libjansson4:amd64=2.14-2+b3 Downloading dependency 266 of 328: libtsan2:amd64=15.2.0-8 Downloading dependency 267 of 328: debconf:amd64=1.5.91 Downloading dependency 268 of 328: libcairo2:amd64=1.18.4-1+b1 Downloading dependency 269 of 328: libdeflate0:amd64=1.23-2 Downloading dependency 270 of 328: openssl:amd64=3.5.4-1 Downloading dependency 271 of 328: perl-modules-5.40:amd64=5.40.1-7 Downloading dependency 272 of 328: libtinfo6:amd64=6.5+20250216-2 Downloading dependency 273 of 328: libpng16-16t64:amd64=1.6.50-1 Downloading dependency 274 of 328: libwebp7:amd64=1.5.0-0.1 Downloading dependency 275 of 328: debhelper:amd64=13.28 Downloading dependency 276 of 328: libsmartcols1:amd64=2.41.2-4 Downloading dependency 277 of 328: fonts-font-awesome:amd64=5.0.10+really4.7.0~dfsg-4.1 Downloading dependency 278 of 328: libxxhash0:amd64=0.8.3-2 Downloading dependency 279 of 328: librtmp1:amd64=2.4+20151223.gitfa8646d.1-3 Downloading dependency 280 of 328: libmount1:amd64=2.41.2-4 Downloading dependency 281 of 328: init-system-helpers:amd64=1.69 Downloading dependency 282 of 328: libuchardet0:amd64=0.0.8-2 Downloading dependency 283 of 328: libaom3:amd64=3.13.1-2 Downloading dependency 284 of 328: libproc2-0:amd64=2:4.0.4-9 Downloading dependency 285 of 328: libubsan1:amd64=15.2.0-8 Downloading dependency 286 of 328: libeigen3-dev:amd64=3.4.0-5 Downloading dependency 287 of 328: libclang-cpp19:amd64=1:19.1.7-10.1 Downloading dependency 288 of 328: libxext6:amd64=2:1.3.4-1+b3 Downloading dependency 289 of 328: libmd0:amd64=1.1.0-2+b1 Downloading dependency 290 of 328: libcap-ng0:amd64=0.8.5-4+b1 Downloading dependency 291 of 328: libjpeg62-turbo:amd64=1:2.1.5-4 Downloading dependency 292 of 328: python3-soupsieve:amd64=2.7-2 Downloading dependency 293 of 328: bash:amd64=5.3-1 Downloading dependency 294 of 328: libgdbm-compat4t64:amd64=1.26-1 Downloading dependency 295 of 328: libedit2:amd64=3.1-20250104-1 Downloading dependency 296 of 328: python3-babel:amd64=2.17.0-1 Downloading dependency 297 of 328: liblsan0:amd64=15.2.0-8 Downloading dependency 298 of 328: libc6:amd64=2.41-12 Downloading dependency 299 of 328: libcatch2-dev:amd64=3.7.1-0.6 Downloading dependency 300 of 328: python3-linkify-it:amd64=2.0.3-1 Downloading dependency 301 of 328: gcc-15:amd64=15.2.0-8 Downloading dependency 302 of 328: libice6:amd64=2:1.1.1-1 Downloading dependency 303 of 328: libgpg-error0:amd64=1.56-2 Downloading dependency 304 of 328: groff-base:amd64=1.23.0-9 Downloading dependency 305 of 328: libpcre2-32-0:amd64=10.46-1 Downloading dependency 306 of 328: gzip:amd64=1.13-1 Downloading dependency 307 of 328: libsm6:amd64=2:1.2.6-1 Downloading dependency 308 of 328: autoconf:amd64=2.72-3.1 Downloading dependency 309 of 328: libabsl20240722:amd64=20240722.0-4 Downloading dependency 310 of 328: libpsl5t64:amd64=0.21.2-1.1+b1 Downloading dependency 311 of 328: file:amd64=1:5.46-5 Downloading dependency 312 of 328: python3-alabaster:amd64=0.7.16-0.1 Downloading dependency 313 of 328: libk5crypto3:amd64=1.22.1-2 Downloading dependency 314 of 328: debianutils:amd64=5.23.2 Downloading dependency 315 of 328: libfreetype6:amd64=2.13.3+dfsg-1 Downloading dependency 316 of 328: autopoint:amd64=0.23.2-1 Downloading dependency 317 of 328: libx11-6:amd64=2:1.8.12-1 Downloading dependency 318 of 328: libctf-nobfd0:amd64=2.45-8 Downloading dependency 319 of 328: libuuid1:amd64=2.41.2-4 Downloading dependency 320 of 328: libpathplan4:amd64=2.42.4-3 Downloading dependency 321 of 328: libgd3:amd64=2.3.3-13 Downloading dependency 322 of 328: python3-markupsafe:amd64=3.0.3-1 Downloading dependency 323 of 328: libaudit-common:amd64=1:4.1.2-1 Downloading dependency 324 of 328: libatomic1:amd64=15.2.0-8 Downloading dependency 325 of 328: libgvpr2:amd64=2.42.4-3 Downloading dependency 326 of 328: libperl5.40:amd64=5.40.1-7 Downloading dependency 327 of 328: libuv1t64:amd64=1.51.0-2 Downloading dependency 328 of 328: libjsoncpp26:amd64=1.9.6-5 env --chdir=/srv/rebuilderd/tmp/rebuilderdlRVcav/out DEB_BUILD_OPTIONS=parallel=6 LANG=C.UTF-8 LC_COLLATE=C.UTF-8 LC_CTYPE=C.UTF-8 SOURCE_DATE_EPOCH=1763627154 SBUILD_CONFIG=/srv/rebuilderd/tmp/debrebuild3DOXkv/debrebuild.sbuildrc.nnlMaBwaNXWB sbuild --build=amd64 --host=amd64 --no-source --no-arch-any --arch-all --chroot=/srv/rebuilderd/tmp/debrebuild3DOXkv/debrebuild.tar.myPxIksRhcsM --chroot-mode=unshare --dist=unstable --no-run-lintian --no-run-piuparts --no-run-autopkgtest --no-apt-update --no-apt-upgrade --no-apt-distupgrade --verbose --nolog --bd-uninstallable-explainer= --build-path=/build/reproducible-path --dsc-dir=libcifpp-9.0.5 /srv/rebuilderd/tmp/rebuilderdlRVcav/inputs/libcifpp_9.0.5-1.dsc I: consider moving your ~/.sbuildrc to /srv/rebuilderd/.config/sbuild/config.pl The Debian buildds switched to the "unshare" backend and sbuild will default to it in the future. To start using "unshare" add this to your `~/.config/sbuild/config.pl`: $chroot_mode = "unshare"; If you want to keep the old "schroot" mode even in the future, add the following to your `~/.config/sbuild/config.pl`: $chroot_mode = "schroot"; $schroot = "schroot"; sbuild (Debian sbuild) 0.89.3+deb13u1 (16 August 2025) on ionos25-amd64.debian.net +==============================================================================+ | libcifpp 9.0.5-1 (amd64) Fri, 21 Nov 2025 16:37:57 +0000 | +==============================================================================+ Package: libcifpp Version: 9.0.5-1 Source Version: 9.0.5-1 Distribution: unstable Machine Architecture: amd64 Host Architecture: amd64 Build Architecture: amd64 Build Type: all I: No tarballs found in /srv/rebuilderd/.cache/sbuild I: Unpacking /srv/rebuilderd/tmp/debrebuild3DOXkv/debrebuild.tar.myPxIksRhcsM to /srv/rebuilderd/tmp/tmp.sbuild.5nWwUCl7Np... I: Setting up the chroot... I: Creating chroot session... I: Setting up log color... I: Setting up apt archive... +------------------------------------------------------------------------------+ | Fetch source files Fri, 21 Nov 2025 16:38:03 +0000 | +------------------------------------------------------------------------------+ Local sources ------------- /srv/rebuilderd/tmp/rebuilderdlRVcav/inputs/libcifpp_9.0.5-1.dsc exists in /srv/rebuilderd/tmp/rebuilderdlRVcav/inputs; copying to chroot +------------------------------------------------------------------------------+ | Install package build dependencies Fri, 21 Nov 2025 16:38:05 +0000 | +------------------------------------------------------------------------------+ Setup apt archive ----------------- Merged Build-Depends: debhelper-compat (= 13), libpcre2-dev, libeigen3-dev, zlib1g-dev, po-debconf, catch2, cmake, doxygen, python3-exhale, python3-sphinx-rtd-theme, python3-myst-parser, build-essential Filtered Build-Depends: debhelper-compat (= 13), libpcre2-dev, libeigen3-dev, zlib1g-dev, po-debconf, catch2, cmake, doxygen, python3-exhale, python3-sphinx-rtd-theme, python3-myst-parser, build-essential dpkg-deb: building package 'sbuild-build-depends-main-dummy' in '/build/reproducible-path/resolver-M0muaZ/apt_archive/sbuild-build-depends-main-dummy.deb'. Install main build dependencies (apt-based resolver) ---------------------------------------------------- Installing build dependencies +------------------------------------------------------------------------------+ | Check architectures Fri, 21 Nov 2025 16:38:08 +0000 | +------------------------------------------------------------------------------+ Arch check ok (amd64 included in any all) +------------------------------------------------------------------------------+ | Build environment Fri, 21 Nov 2025 16:38:09 +0000 | +------------------------------------------------------------------------------+ Kernel: Linux 6.12.57+deb13-cloud-amd64 #1 SMP PREEMPT_DYNAMIC Debian 6.12.57-1 (2025-11-05) amd64 (x86_64) Toolchain package versions: binutils_2.45-8 dpkg-dev_1.22.21 g++-15_15.2.0-8 gcc-15_15.2.0-8 libc6-dev_2.41-12 libstdc++-15-dev_15.2.0-8 libstdc++6_15.2.0-8 linux-libc-dev_6.17.8-1 Package versions: autoconf_2.72-3.1 automake_1:1.18.1-3 autopoint_0.23.2-1 autotools-dev_20240727.1 base-files_14 base-passwd_3.6.8 bash_5.3-1 binutils_2.45-8 binutils-common_2.45-8 binutils-x86-64-linux-gnu_2.45-8 bsdextrautils_2.41.2-4 build-essential_12.12 bzip2_1.0.8-6 ca-certificates_20250419 catch2_3.7.1-0.6 cmake_4.1.1+really3.31.6-2 cmake-data_4.1.1+really3.31.6-2 coreutils_9.7-3 cpp_4:15.2.0-4 cpp-15_15.2.0-8 cpp-15-x86-64-linux-gnu_15.2.0-8 cpp-x86-64-linux-gnu_4:15.2.0-4 dash_0.5.12-12 debconf_1.5.91 debhelper_13.28 debianutils_5.23.2 dh-autoreconf_21 dh-strip-nondeterminism_1.15.0-1 diffutils_1:3.12-1 docutils-common_0.22.3+dfsg-1 doxygen_1.9.8+ds-2.1 dpkg_1.22.21 dpkg-dev_1.22.21 dwz_0.16-2 file_1:5.46-5 findutils_4.10.0-3 fontconfig_2.15.0-2.4 fontconfig-config_2.15.0-2.4 fonts-dejavu-core_2.37-8 fonts-dejavu-mono_2.37-8 fonts-font-awesome_5.0.10+really4.7.0~dfsg-4.1 fonts-lato_2.015-1 g++_4:15.2.0-4 g++-15_15.2.0-8 g++-15-x86-64-linux-gnu_15.2.0-8 g++-x86-64-linux-gnu_4:15.2.0-4 gcc_4:15.2.0-4 gcc-15_15.2.0-8 gcc-15-base_15.2.0-8 gcc-15-x86-64-linux-gnu_15.2.0-8 gcc-x86-64-linux-gnu_4:15.2.0-4 gettext_0.23.2-1 gettext-base_0.23.2-1 graphviz_2.42.4-3 grep_3.12-1 groff-base_1.23.0-9 gzip_1.13-1 hostname_3.25 init-system-helpers_1.69 intltool-debian_0.35.0+20060710.6 libabsl20240722_20240722.0-4 libacl1_2.3.2-2+b1 libann0_1.1.2+doc-9+b1 libaom3_3.13.1-2 libarchive-zip-perl_1.68-1 libarchive13t64_3.7.4-4+b1 libasan8_15.2.0-8 libatomic1_15.2.0-8 libattr1_1:2.5.2-3 libaudit-common_1:4.1.2-1 libaudit1_1:4.1.2-1 libavif16_1.3.0-1+b1 libbinutils_2.45-8 libblkid1_2.41.2-4 libbrotli1_1.1.0-2+b7 libbsd0_0.12.2-2 libbz2-1.0_1.0.8-6 libc-bin_2.41-12 libc-dev-bin_2.41-12 libc6_2.41-12 libc6-dev_2.41-12 libcairo2_1.18.4-1+b1 libcap-ng0_0.8.5-4+b1 libcap2_1:2.75-10+b1 libcatch2-dev_3.7.1-0.6 libcc1-0_15.2.0-8 libcdt5_2.42.4-3 libcgraph6_2.42.4-3 libclang-cpp19_1:19.1.7-10.1 libclang1-19_1:19.1.7-10.1 libcom-err2_1.47.2-3+b3 libcrypt-dev_1:4.5.1-1 libcrypt1_1:4.5.1-1 libctf-nobfd0_2.45-8 libctf0_2.45-8 libcurl4t64_8.17.0-2 libdatrie1_0.2.13-4 libdav1d7_1.5.2-1 libdb5.3t64_5.3.28+dfsg2-10 libde265-0_1.0.16-1 libdebconfclient0_0.281 libdebhelper-perl_13.28 libdeflate0_1.23-2 libdpkg-perl_1.22.21 libedit2_3.1-20250104-1 libeigen3-dev_3.4.0-5 libelf1t64_0.194-1 libexpat1_2.7.3-1 libffi8_3.5.2-2 libfile-stripnondeterminism-perl_1.15.0-1 libfmt10_10.1.1+ds1-4 libfontconfig1_2.15.0-2.4 libfreetype6_2.13.3+dfsg-1 libfribidi0_1.0.16-3 libgav1-1_0.19.0-3+b1 libgcc-15-dev_15.2.0-8 libgcc-s1_15.2.0-8 libgcrypt20_1.11.2-3 libgd3_2.3.3-13 libgdbm-compat4t64_1.26-1 libgdbm6t64_1.26-1 libglib2.0-0t64_2.86.2-1 libgmp10_2:6.3.0+dfsg-5 libgnutls30t64_3.8.10-3 libgomp1_15.2.0-8 libgpg-error0_1.56-2 libgprofng0_2.45-8 libgraphite2-3_1.3.14-11 libgssapi-krb5-2_1.22.1-2 libgts-0.7-5t64_0.7.6+darcs121130-5.2+b1 libgvc6_2.42.4-3 libgvpr2_2.42.4-3 libharfbuzz0b_12.1.0-1 libheif-plugin-dav1d_1.20.2-2+b1 libheif-plugin-libde265_1.20.2-2+b1 libheif1_1.20.2-2+b1 libhogweed6t64_3.10.2-1 libhwasan0_15.2.0-8 libice6_2:1.1.1-1 libidn2-0_2.3.8-4 libimagequant0_4.4.0-3 libisl23_0.27-1 libitm1_15.2.0-8 libjansson4_2.14-2+b3 libjbig0_2.1-6.1+b2 libjpeg62-turbo_1:2.1.5-4 libjs-jquery_3.7.1+dfsg+~3.5.33-1 libjs-sphinxdoc_8.2.3-9 libjson-perl_4.10000-1 libjsoncpp26_1.9.6-5 libk5crypto3_1.22.1-2 libkeyutils1_1.6.3-6 libkrb5-3_1.22.1-2 libkrb5support0_1.22.1-2 liblab-gamut1_2.42.4-3 libldap2_2.6.10+dfsg-1 liblerc4_4.0.0+ds-5 libllvm19_1:19.1.7-10.1 liblsan0_15.2.0-8 libltdl7_2.5.4-7 liblz4-1_1.10.0-6 liblzma5_5.8.1-2 libmagic-mgc_1:5.46-5 libmagic1t64_1:5.46-5 libmd0_1.1.0-2+b1 libmount1_2.41.2-4 libmpc3_1.3.1-2 libmpfr6_4.2.2-2 libncursesw6_6.5+20250216-2 libnettle8t64_3.10.2-1 libnghttp2-14_1.64.0-1.1+b1 libnghttp3-9_1.12.0-1 libngtcp2-16_1.16.0-1 libngtcp2-crypto-ossl0_1.16.0-1 libp11-kit0_0.25.10-1 libpam-modules_1.7.0-5 libpam-modules-bin_1.7.0-5 libpam-runtime_1.7.0-5 libpam0g_1.7.0-5 libpango-1.0-0_1.56.3-2 libpangocairo-1.0-0_1.56.3-2 libpangoft2-1.0-0_1.56.3-2 libpathplan4_2.42.4-3 libpcre2-16-0_10.46-1 libpcre2-32-0_10.46-1 libpcre2-8-0_10.46-1 libpcre2-dev_10.46-1 libpcre2-posix3_10.46-1 libperl5.40_5.40.1-7 libpipeline1_1.5.8-1 libpixman-1-0_0.46.4-1 libpkgconf3_1.8.1-4 libpng16-16t64_1.6.50-1 libproc2-0_2:4.0.4-9 libpsl5t64_0.21.2-1.1+b1 libpython3-stdlib_3.13.7-1 libpython3.13-minimal_3.13.9-1 libpython3.13-stdlib_3.13.9-1 libquadmath0_15.2.0-8 librav1e0.8_0.8.1-6 libreadline8t64_8.3-3 librhash1_1.4.6-1 librtmp1_2.4+20151223.gitfa8646d.1-3 libsasl2-2_2.1.28+dfsg1-10 libsasl2-modules-db_2.1.28+dfsg1-10 libseccomp2_2.6.0-2 libselinux1_3.9-2 libsframe2_2.45-8 libsharpyuv0_1.5.0-0.1 libsm6_2:1.2.6-1 libsmartcols1_2.41.2-4 libsqlite3-0_3.46.1-8 libssh2-1t64_1.11.1-1 libssl3t64_3.5.4-1 libstdc++-15-dev_15.2.0-8 libstdc++6_15.2.0-8 libsvtav1enc2_2.3.0+dfsg-1 libsystemd0_259~rc1-1 libtasn1-6_4.20.0-2 libthai-data_0.1.29-2 libthai0_0.1.29-2+b1 libtiff6_4.7.1-1 libtinfo6_6.5+20250216-2 libtool_2.5.4-7 libtsan2_15.2.0-8 libubsan1_15.2.0-8 libuchardet0_0.0.8-2 libudev1_259~rc1-1 libunistring5_1.3-2 libuuid1_2.41.2-4 libuv1t64_1.51.0-2 libwebp7_1.5.0-0.1 libx11-6_2:1.8.12-1 libx11-data_2:1.8.12-1 libxapian30_1.4.29-3 libxau6_1:1.0.11-1 libxaw7_2:1.0.16-1 libxcb-render0_1.17.0-2+b1 libxcb-shm0_1.17.0-2+b1 libxcb1_1.17.0-2+b1 libxdmcp6_1:1.1.5-1 libxext6_2:1.3.4-1+b3 libxml2-16_2.15.1+dfsg-0.4 libxmu6_2:1.1.3-3+b4 libxpm4_1:3.5.17-1+b3 libxrender1_1:0.9.12-1 libxslt1.1_1.1.43-0.3 libxt6t64_1:1.2.1-1.3 libxxhash0_0.8.3-2 libyaml-0-2_0.2.5-2 libyuv0_0.0.1919.20250919-1 libz3-4_4.13.3-1 libzstd1_1.5.7+dfsg-2 linux-libc-dev_6.17.8-1 m4_1.4.20-2 make_4.4.1-3 man-db_2.13.1-1 mawk_1.3.4.20250131-1 media-types_14.0.0 ncurses-base_6.5+20250216-2 ncurses-bin_6.5+20250216-2 netbase_6.5 openssl_3.5.4-1 openssl-provider-legacy_3.5.4-1 patch_2.8-2 perl_5.40.1-7 perl-base_5.40.1-7 perl-modules-5.40_5.40.1-7 pkg-config_1.8.1-4 pkgconf_1.8.1-4 pkgconf-bin_1.8.1-4 po-debconf_1.0.21+nmu1 procps_2:4.0.4-9 python-babel-localedata_2.17.0-1 python3_3.13.7-1 python3-alabaster_0.7.16-0.1 python3-babel_2.17.0-1 python3-breathe_4.36.0-2 python3-bs4_4.14.2-1 python3-certifi_2025.1.31+ds-1 python3-chardet_5.2.0+dfsg-2 python3-charset-normalizer_3.4.3-1 python3-defusedxml_0.7.1-3 python3-docutils_0.22.3+dfsg-1 python3-exhale_0.3.7-1 python3-idna_3.10-1 python3-imagesize_1.4.1-1 python3-jinja2_3.1.6-1 python3-linkify-it_2.0.3-1 python3-lxml_6.0.2-1 python3-markdown-it_3.0.0-3 python3-markupsafe_3.0.3-1 python3-mdit-py-plugins_0.5.0-1 python3-mdurl_0.1.2-1 python3-minimal_3.13.7-1 python3-myst-parser_4.0.1-1 python3-packaging_25.0-1 python3-pygments_2.18.0+dfsg-2 python3-requests_2.32.5+dfsg-1 python3-roman-numerals_3.1.0-2 python3-six_1.17.0-1 python3-snowballstemmer_3.0.1-1 python3-soupsieve_2.7-2 python3-sphinx_8.2.3-9 python3-sphinx-rtd-theme_3.0.2+dfsg-3 python3-sphinxcontrib.jquery_4.1-6 python3-typing-extensions_4.15.0-1 python3-uc-micro_1.0.3-1 python3-urllib3_2.5.0-1 python3-yaml_6.0.2-2 python3.13_3.13.9-1 python3.13-minimal_3.13.9-1 readline-common_8.3-3 rpcsvc-proto_1.4.3-1 sed_4.9-2 sensible-utils_0.0.26 sgml-base_1.31+nmu1 sphinx-common_8.2.3-9 sphinx-rtd-theme-common_3.0.2+dfsg-3 sysvinit-utils_3.15-6 tar_1.35+dfsg-3.1 tzdata_2025b-5 util-linux_2.41.2-4 x11-common_1:7.7+26 xml-core_0.19 xz-utils_5.8.1-2 zlib1g_1:1.3.dfsg+really1.3.1-1+b1 zlib1g-dev_1:1.3.dfsg+really1.3.1-1+b1 +------------------------------------------------------------------------------+ | Build Fri, 21 Nov 2025 16:38:09 +0000 | +------------------------------------------------------------------------------+ Unpack source ------------- -----BEGIN PGP SIGNED MESSAGE----- Hash: SHA512 Format: 3.0 (quilt) Source: libcifpp Binary: libcifpp-dev, libcifpp-doc, libcifpp9, libcifpp-data Architecture: any all Version: 9.0.5-1 Maintainer: Debian Med Packaging Team Uploaders: Maarten L. Hekkelman , Andreas Tille , Homepage: https://github.com/PDB-REDO/libcifpp Standards-Version: 4.7.2 Vcs-Browser: https://salsa.debian.org/med-team/libcifpp Vcs-Git: https://salsa.debian.org/med-team/libcifpp.git Testsuite: autopkgtest Testsuite-Triggers: build-essential, cmake, zlib1g-dev Build-Depends: debhelper-compat (= 13), libpcre2-dev, libeigen3-dev, zlib1g-dev, po-debconf, catch2, cmake, doxygen, python3-exhale, python3-sphinx-rtd-theme, python3-myst-parser Package-List: libcifpp-data deb libs optional arch=all libcifpp-dev deb libdevel optional arch=any libcifpp-doc deb doc optional arch=all libcifpp9 deb libs optional arch=any Checksums-Sha1: 717fbe4e4724b1a6d3a53666d0311741a690b032 2735687 libcifpp_9.0.5.orig.tar.gz b12bba57bff43dfa638bbd90a6d9201263b7866f 9144 libcifpp_9.0.5-1.debian.tar.xz Checksums-Sha256: 2ac6bf93a799f1139fa3c8b69348f4fe3da5e4bcb54e7d779b8c3fb8eca2f991 2735687 libcifpp_9.0.5.orig.tar.gz 8579f6c206d415020b863378dc5796ac144952f7d6c94f8d50533714b4b63b01 9144 libcifpp_9.0.5-1.debian.tar.xz Files: dd981aca2ba45e2db7b5e4b77378a5a8 2735687 libcifpp_9.0.5.orig.tar.gz 6a7011c0d4f8d59c6968cafeda0ea2e3 9144 libcifpp_9.0.5-1.debian.tar.xz -----BEGIN PGP SIGNATURE----- iQJKBAEBCgA0FiEEpytoJCJrtAfiS56AWHUD7Hrn7c4FAmke1YkWHG1hYXJ0ZW5A aGVra2VsbWFuLmNvbQAKCRBYdQPseuftzh+dD/9lrRM//uILtdqHYw0GTD3wEw/7 fpVPKAw3CFOW3kvrN10mxVMvvzl/mqqdac51N9uZfvGXdy+7amStjDLsoUkCZogW 1TCJjyH2qB59y8Iv+cgNld1/DvJOjb0vqo/IM0S3oZRtN+g2Zzh8o53a7pQLmDc3 MPPowwpjNhTw9CjM9uE15NJeoKw2ZqUMICLmqTC64mPbv9TK/hanEOAUU03Ox2Xh nPt/B4ktD6XCFcE0GwINTXhlbPqi2grmt6MpB8cFFQwBEcBfQInC56+fkwExciaJ VC09c4Kgl50oyzDaoWACgIK/D/WeNZz7OXBZ1PxCbmtXk7CbBW4q1GKK3UROOv6l xPm5sMTLvbzY8v8yqXRSVdbsdm89AVtYbH92GOH9GLKYPq3/Ot8jf1LoZRkocyN7 CkxF9TAZhqz/4UkOwDPYDmjvIuh7xZNPnera44OhUWwPX4VONrUwJ0w/7VN50f9w pje4IvTTOOexS9jkNg/FgUdELnqXa1Qh6CSgwZnh4lKMBiFMM3ozEBkj5Iina51Y XLJWfEo3GnT/rtEX9WjwrRwKBTURu3AggEPLmkV7+FvijApCsdOzsJoDp7cCB0AI etWQJFPW1g2tP63JT+OqiGe6wXtvh/RH63IggBh/tXZUFMjSAJECjzY2M4a6rGTH +V5ibKI9iFnd70K7/A== =UMDt -----END PGP SIGNATURE----- dpkg-source: warning: cannot verify inline signature for ./libcifpp_9.0.5-1.dsc: unsupported subcommand dpkg-source: info: extracting libcifpp in /build/reproducible-path/libcifpp-9.0.5 dpkg-source: info: unpacking libcifpp_9.0.5.orig.tar.gz dpkg-source: info: unpacking libcifpp_9.0.5-1.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying soname.patch Check disk space ---------------- Sufficient free space for build User Environment ---------------- APT_CONFIG=/var/lib/sbuild/apt.conf DEB_BUILD_OPTIONS=parallel=6 HOME=/sbuild-nonexistent LANG=C.UTF-8 LC_ALL=C.UTF-8 LC_COLLATE=C.UTF-8 LC_CTYPE=C.UTF-8 LOGNAME=sbuild PATH=/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin:/usr/games SHELL=/bin/sh SOURCE_DATE_EPOCH=1763627154 USER=sbuild dpkg-buildpackage ----------------- Command: dpkg-buildpackage --sanitize-env -us -uc -A dpkg-buildpackage: info: source package libcifpp dpkg-buildpackage: info: source version 9.0.5-1 dpkg-buildpackage: info: source distribution unstable dpkg-buildpackage: info: source changed by Maarten L. Hekkelman dpkg-source --before-build . debian/rules clean dh clean dh: warning: incorrect value in hardening option of DEB_BUILD_MAINT_OPTIONS variable: optimize=-lto dh_clean rm -f debian/debhelper-build-stamp rm -rf debian/.debhelper/ rm -f -- debian/libcifpp-dev.substvars debian/libcifpp-doc.substvars debian/libcifpp9.substvars debian/libcifpp-data.substvars debian/files rm -fr -- debian/libcifpp-dev/ debian/tmp/ debian/libcifpp-doc/ debian/libcifpp9/ debian/libcifpp-data/ find . \( \( \ \( -path .\*/.git -o -path .\*/.svn -o -path .\*/.bzr -o -path .\*/.hg -o -path .\*/CVS -o -path .\*/.pc -o -path .\*/_darcs \) -prune -o -type f -a \ \( -name '#*#' -o -name '.*~' -o -name '*~' -o -name DEADJOE \ -o -name '*.orig' -o -name '*.rej' -o -name '*.bak' \ -o -name '.*.orig' -o -name .*.rej -o -name '.SUMS' \ -o -name TAGS -o \( -path '*/.deps/*' -a -name '*.P' \) \ \) -exec rm -f {} + \) -o \ \( -type d -a \( -name autom4te.cache -o -name __pycache__ \) -prune -exec rm -rf {} + \) \) debian/rules binary-indep dh binary-indep dh: warning: incorrect value in hardening option of DEB_BUILD_MAINT_OPTIONS variable: optimize=-lto dh_update_autotools_config -i dh_autoreconf -i debian/rules override_dh_auto_configure make[1]: Entering directory '/build/reproducible-path/libcifpp-9.0.5' dh_auto_configure -- -DBUILD_SHARED_LIBS=ON -DENABLE_TESTING=ON -DCIFPP_DOWNLOAD_CCD=OFF -DBUILD_DOCUMENTATION=ON cd obj-x86_64-linux-gnu && DEB_PYTHON_INSTALL_LAYOUT=deb PKG_CONFIG=/usr/bin/pkg-config cmake -DCMAKE_INSTALL_PREFIX=/usr -DCMAKE_BUILD_TYPE=None -DCMAKE_INSTALL_SYSCONFDIR=/etc -DCMAKE_INSTALL_LOCALSTATEDIR=/var -DCMAKE_EXPORT_NO_PACKAGE_REGISTRY=ON -DCMAKE_FIND_USE_PACKAGE_REGISTRY=OFF -DCMAKE_FIND_PACKAGE_NO_PACKAGE_REGISTRY=ON -DFETCHCONTENT_FULLY_DISCONNECTED=ON -DCMAKE_INSTALL_RUNSTATEDIR=/run -DCMAKE_SKIP_INSTALL_ALL_DEPENDENCY=ON "-GUnix Makefiles" -DCMAKE_VERBOSE_MAKEFILE=ON -DCMAKE_INSTALL_LIBDIR=lib/x86_64-linux-gnu -DBUILD_SHARED_LIBS=ON -DENABLE_TESTING=ON -DCIFPP_DOWNLOAD_CCD=OFF -DBUILD_DOCUMENTATION=ON .. -- The CXX compiler identification is GNU 15.2.0 -- The C compiler identification is GNU 15.2.0 -- Detecting CXX compiler ABI info -- Detecting CXX compiler ABI info - done -- Check for working CXX compiler: /usr/bin/c++ - skipped -- Detecting CXX compile features -- Detecting CXX compile features - done -- Detecting C compiler ABI info -- Detecting C compiler ABI info - done -- Check for working C compiler: /usr/bin/cc - skipped -- Detecting C compile features -- Detecting C compile features - done -- Looking for C++ include atomic -- Looking for C++ include atomic - found -- Performing Test _CXX_ATOMIC_BUILTIN -- Performing Test _CXX_ATOMIC_BUILTIN - Success -- Performing Test CMAKE_HAVE_LIBC_PTHREAD -- Performing Test CMAKE_HAVE_LIBC_PTHREAD - Success -- Found Threads: TRUE -- Found PkgConfig: /usr/bin/pkg-config (found version "1.8.1") -- Checking for module 'libpcre2-8' -- Found libpcre2-8, version 10.46 -- Git hash not found -- Performing Test COMPILER_HAS_HIDDEN_VISIBILITY -- Performing Test COMPILER_HAS_HIDDEN_VISIBILITY - Success -- Performing Test COMPILER_HAS_HIDDEN_INLINE_VISIBILITY -- Performing Test COMPILER_HAS_HIDDEN_INLINE_VISIBILITY - Success -- Performing Test COMPILER_HAS_DEPRECATED_ATTR -- Performing Test COMPILER_HAS_DEPRECATED_ATTR - Success -- Found Doxygen: /usr/bin/doxygen (found version "1.9.8") found components: doxygen dot -- Found Sphinx: /usr/bin/sphinx-build -- Configuring done (1.9s) -- Generating done (0.0s) CMake Warning: Manually-specified variables were not used by the project: CMAKE_EXPORT_NO_PACKAGE_REGISTRY CMAKE_FIND_PACKAGE_NO_PACKAGE_REGISTRY ENABLE_TESTING -- Build files have been written to: /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu make[1]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5' rm -f debian/libcifpp-data.debhelper.log debian/libcifpp-doc.debhelper.log debian/rules override_dh_auto_build make[1]: Entering directory '/build/reproducible-path/libcifpp-9.0.5' export http_proxy=127.0.0.1:9 export https_proxy=127.0.0.1:9 dh_auto_build cd obj-x86_64-linux-gnu && make -j6 INSTALL="install --strip-program=true" VERBOSE=1 make[2]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' /usr/bin/cmake -S/build/reproducible-path/libcifpp-9.0.5 -B/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu --check-build-system CMakeFiles/Makefile.cmake 0 /usr/bin/cmake -E cmake_progress_start /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/CMakeFiles /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu//CMakeFiles/progress.marks make -f CMakeFiles/Makefile2 all make[3]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make -f CMakeFiles/cifpp.dir/build.make CMakeFiles/cifpp.dir/depend make -f docs/CMakeFiles/Doxygen-libcifpp.dir/build.make docs/CMakeFiles/Doxygen-libcifpp.dir/depend make -f docs/CMakeFiles/Sphinx-libcifpp.dir/build.make docs/CMakeFiles/Sphinx-libcifpp.dir/depend make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/reproducible-path/libcifpp-9.0.5 /build/reproducible-path/libcifpp-9.0.5 /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/CMakeFiles/cifpp.dir/DependInfo.cmake "--color=" make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/reproducible-path/libcifpp-9.0.5 /build/reproducible-path/libcifpp-9.0.5/docs /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/docs /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/docs/CMakeFiles/Sphinx-libcifpp.dir/DependInfo.cmake "--color=" make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/reproducible-path/libcifpp-9.0.5 /build/reproducible-path/libcifpp-9.0.5/docs /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/docs /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/docs/CMakeFiles/Doxygen-libcifpp.dir/DependInfo.cmake "--color=" make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make -f docs/CMakeFiles/Doxygen-libcifpp.dir/build.make docs/CMakeFiles/Doxygen-libcifpp.dir/build make -f CMakeFiles/cifpp.dir/build.make CMakeFiles/cifpp.dir/build make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make -f docs/CMakeFiles/Sphinx-libcifpp.dir/build.make docs/CMakeFiles/Sphinx-libcifpp.dir/build make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' [ 4%] Building CXX object CMakeFiles/cifpp.dir/src/category.cpp.o [ 6%] Building CXX object CMakeFiles/cifpp.dir/src/condition.cpp.o [ 6%] Generating xml /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/category.cpp.o -MF CMakeFiles/cifpp.dir/src/category.cpp.o.d -o CMakeFiles/cifpp.dir/src/category.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/category.cpp cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/docs && /usr/bin/cmake -E make_directory /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/docs/xml /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/condition.cpp.o -MF CMakeFiles/cifpp.dir/src/condition.cpp.o.d -o CMakeFiles/cifpp.dir/src/condition.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/condition.cpp [ 8%] Building CXX object CMakeFiles/cifpp.dir/src/dictionary_parser.cpp.o [ 10%] Generating xml /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/dictionary_parser.cpp.o -MF CMakeFiles/cifpp.dir/src/dictionary_parser.cpp.o.d -o CMakeFiles/cifpp.dir/src/dictionary_parser.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/dictionary_parser.cpp [ 12%] Building CXX object CMakeFiles/cifpp.dir/src/datablock.cpp.o cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/docs && /usr/bin/cmake -E make_directory /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/docs/xml /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/datablock.cpp.o -MF CMakeFiles/cifpp.dir/src/datablock.cpp.o.d -o CMakeFiles/cifpp.dir/src/datablock.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/datablock.cpp [ 14%] Generating docs cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/docs && /usr/bin/doxygen /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/docs/Doxyfile [ 16%] Generating docs cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/docs && /usr/bin/doxygen /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/docs/Doxyfile Doxygen version used: 1.9.8 Searching for include files... Searching for example files... Searching for images... Searching for dot files... Searching for msc files... Searching for dia files... Searching for files to exclude Searching INPUT for files to process... Searching for files in directory /build/reproducible-path/libcifpp-9.0.5/include Searching for files in directory /build/reproducible-path/libcifpp-9.0.5/include/cif++ Searching for files in directory /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb Reading and parsing tag files Parsing files Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/atom_type.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/atom_type.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/category.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/category.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/compound.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/compound.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/condition.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/condition.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/datablock.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/datablock.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/dictionary_parser.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/dictionary_parser.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/exports.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/exports.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/file.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/file.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/format.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/format.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/forward_decl.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/forward_decl.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/gzio.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/gzio.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/item.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/item.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/iterator.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/iterator.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/model.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/model.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/parser.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/parser.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb/cif2pdb.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb/cif2pdb.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb/io.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb/io.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb/pdb2cif.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb/pdb2cif.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.Doxygen version used: 1.9.8 Searching for include files... Searching for example files... Searching for images... Searching for dot files... Searching for msc files... Searching for dia files... Searching for files to exclude Searching INPUT for files to process... Searching for files in directory /build/reproducible-path/libcifpp-9.0.5/include Searching for files in directory /build/reproducible-path/libcifpp-9.0.5/include/cif++ Searching for files in directory /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb Reading and parsing tag files Parsing files Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/atom_type.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/atom_type.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/category.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/category.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/compound.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/compound.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/condition.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/condition.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/datablock.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/datablock.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/dictionary_parser.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/dictionary_parser.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/exports.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/exports.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/file.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/file.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/format.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/format.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/forward_decl.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/forward_decl.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/gzio.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/gzio.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/item.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/item.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/iterator.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/iterator.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/model.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/model.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/parser.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/parser.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb/cif2pdb.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb/cif2pdb.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb/io.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb/io.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb/pdb2cif.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb/pdb2cif.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0./build/reproducible-path/libcifpp-9.0.5/include/cif++/model.hpp:889: warning: Compound cif::mm::structure_open_options is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:615: warning: Compound cif::sub_matrix is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:176: warning: Compound cif::validation_exception is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/model.hpp:889: warning: Compound cif::mm::structure_open_options is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:615: warning: Compound cif::sub_matrix is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:176: warning: Compound cif::validation_exception is not documented. 5/include/cif++/pdb/tls.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb/tls.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/point.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/point.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/row.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/row.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/symmetry.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/symmetry.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/text.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/text.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/utilities.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/utilities.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp... Building macro definition list... Building group list... Building directory list... Building namespace list... Building file list... Building class list... Building concept list... Computing nesting relations for classes... Associating documentation with classes... Associating documentation with concepts... Associating documentation with modules... Building example list... Searching for enumerations... Searching for documented typedefs... Searching for members imported via using declarations... Searching for included using directives... Searching for documented variables... Building interface member list... Building member list... Searching for friends... Searching for documented defines... Computing class inheritance relations... Computing class usage relations... Flushing cached template relations that have become invalid... Computing class relations... Add enum values to enums... Searching for member function documentation... Creating members for template instances... Building page list... Search for main page... Computing page relations... Determining the scope of groups... Computing module relations... Sorting lists... Determining which enums are documented Computing member relations... Building full member lists recursively... Adding members to member groups. Computing member references... Inheriting documentation... Generating disk names... Adding source references... Adding xrefitems... Sorting member lists... Setting anonymous enum type... Computing dependencies between directories... Generating citations page... Counting members... Counting data structures... Resolving user defined references... Finding anchors and sections in the documentation... Transferring function references... Combining using relations... Adding members to index pages... Correcting members for VHDL... Computing tooltip texts... Generating style sheet... Generating search indices... Generating example documentation... Generating file sources... Generating code for file cif++.hpp... Generating code for file cif++/atom_type.hpp... Generating code for file cif++/category.hpp... Generating code for file cif++/compound.hpp... Generating code for file cif++/condition.hpp... Generating code for file cif++/datablock.hpp... Generating code for file cif++/dictionary_parser.hpp... Generating code for file cif++/exports.hpp... Generating code for file cif++/file.hpp... Generating code for file cif++/format.hpp... Generating code for file cif++/forward_decl.hpp... Generating code for file cif++/gzio.hpp... Generating code for file cif++/item.hpp... Generating code for file cif++/iterator.hpp... Generating code for file cif++/matrix.hpp... Generating code for file cif++/model.hpp... Generating code for file cif++/parser.hpp... Generating code for file cif++/pdb.hpp... Generating code for file cif++/pdb/cif2pdb.hpp... Generating code for file cif++/pdb/io.hpp... Generating code for file cif++/pdb/pdb2cif.hpp... Generating code for file cif++/pdb/tls.hpp... Generating code for file c5/include/cif++/pdb/tls.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb/tls.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/point.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/point.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/row.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/row.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/symmetry.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/symmetry.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/text.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/text.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/utilities.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/utilities.hpp... Preprocessing /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp... Parsing file /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp... Building macro definition list... Building group list... Building directory list... Building namespace list... Building file list... Building class list... Building concept list... Computing nesting relations for classes... Associating documentation with classes... Associating documentation with concepts... Associating documentation with modules... Building example list... Searching for enumerations... Searching for documented typedefs... Searching for members imported via using declarations... Searching for included using directives... Searching for documented variables... Building interface member list... Building member list... Searching for friends... Searching for documented defines... Computing class inheritance relations... Computing class usage relations... Flushing cached template relations that have become invalid... Computing class relations... Add enum values to enums... Searching for member function documentation... Creating members for template instances... Building page list... Search for main page... Computing page relations... Determining the scope of groups... Computing module relations... Sorting lists... Determining which enums are documented Computing member relations... Building full member lists recursively... Adding members to member groups. Computing member references... Inheriting documentation... Generating disk names... Adding source references... Adding xrefitems... Sorting member lists... Setting anonymous enum type... Computing dependencies between directories... Generating citations page... Counting members... Counting data structures... Resolving user defined references... Finding anchors and sections in the documentation... Transferring function references... Combining using relations... Adding members to index pages... Correcting members for VHDL... Computing tooltip texts... Generating style sheet... Generating search indices... Generating example documentation... Generating file sources... Generating code for file cif++.hpp... Generating code for file cif++/atom_type.hpp... Generating code for file cif++/category.hpp... Generating code for file cif++/compound.hpp... Generating code for file cif++/condition.hpp... Generating code for file cif++/datablock.hpp... Generating code for file cif++/dictionary_parser.hpp... Generating code for file cif++/exports.hpp... Generating code for file cif++/file.hpp... Generating code for file cif++/format.hpp... Generating code for file cif++/forward_decl.hpp... Generating code for file cif++/gzio.hpp... Generating code for file cif++/item.hpp... Generating code for file cif++/iterator.hpp... Generating code for file cif++/matrix.hpp... Generating code for file cif++/model.hpp... Generating code for file cif++/parser.hpp... Generating code for file cif++/pdb.hpp... Generating code for file cif++/pdb/cif2pdb.hpp... Generating code for file cif++/pdb/io.hpp... Generating code for file cif++/pdb/pdb2cif.hpp... Generating code for file cif++/pdb/tls.hpp... Generating code for file c/build/reproducible-path/libcifpp-9.0.5/include/cif++/text.hpp:360: warning: Member from_chars_function (typedef) of namespace cif is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/text.hpp:381: warning: Member charconv (typedef) of namespace cif is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/text.hpp:384: warning: Member from_chars(const char *s, const char *e, T &v) (function) of namespace cif is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:164: warning: Member make_error_code(validation_error e) (function) of namespace cif is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:169: warning: Member make_error_condition(validation_error e) (function) of namespace cif is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/text.hpp:360: warning: Member from_chars_function (typedef) of namespace cif is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/text.hpp:381: warning: Member charconv (typedef) of namespace cif is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/text.hpp:384: warning: Member from_chars(const char *s, const char *e, T &v) (function) of namespace cif is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:164: warning: Member make_error_code(validation_error e) (function) of namespace cif is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:169: warning: Member make_error_condition(validation_error e) (function) of namespace cif is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/text.hpp:360: warning: Member from_chars_function (typedef) of namespace cif is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/text.hpp:381: warning: Member charconv (typedef) of namespace cif is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/text.hpp:384: warning: Member from_chars(const char *s, const char *e, T &v) (function) of namespace cif is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/category.hpp:1008: warning: Member value_provider_type (typedef) of class cif::category is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/category.hpp:167: warning: Member operator=(category rhs) (function) of class cif::category is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:164: warning: Member make_error_code(validation_error e) (function) of namespace cif is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:169: warning: Member make_error_condition(validation_error e) (function) of namespace cif is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/text.hpp:360: warning: Member from_chars_function (typedef) of namespace cif is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/text.hpp:381: warning: Member charconv (typedef) of namespace cif is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/category.hpp:977: warning: Member emplace(const_iterator b, const_iterator e) (function) of class cif::category is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/category.hpp:178: warning: Member swap(category &a, category &b) noexcept (friend) of class cif::category is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/text.hpp:384: warning: Member from_chars(const char *s, const char *e, T &v) (function) of namespace cif is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:164: warning: Member make_error_code(validation_error e) (function) of namespace cif is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:169: warning: Member make_error_condition(validation_error e) (function) of namespace cif is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/compound.hpp:175: warning: Member one_letter_code() const (function) of class cif::compound is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/compound.hpp:295: warning: Member report_missing_compound(std::string_view compound_id) (function) of class cif::compound_factory is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/compound.hpp:297: warning: Member get_report_missing() const (function) of class cif::compound_factory is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/compound.hpp:299: warning: Member set_report_missing(bool report) (function) of class cif::compound_factory is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/compound.hpp:338: warning: Member compound_source(const file &file) (function) of class cif::compound_source is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/category.hpp:1008: warning: Member value_provider_type (typedef) of class cif::category is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/category.hpp:167: warning: Member operator=(category rhs) (function) of class cif::category is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/datablock.hpp:79: warning: Member swap_(datablock &a, datablock &b) noexcept (friend) of class cif::datablock is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/category.hpp:977: warning: Member emplace(const_iterator b, const_iterator e) (function) of class cif::category is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class cif::matrix_expression is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/category.hpp:178: warning: Member swap(category &a, category &b) noexcept (friend) of class cif::category is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/item.hpp:253: warning: Member operator<=>(const item &rhs) const =default (function) of class cif::item is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:284: warning: Member item_alias(const std::string &alias_name, const std::string &dictionary, const std::string &version) (function) of struct cif::item_alias is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:291: warning: Member item_alias(const item_alias &)=default (function) of struct cif::item_alias is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:292: warning: Member operator=(const item_alias &)=default (function) of struct cif::item_alias is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/compound.hpp:175: warning: Member one_letter_code() const (function) of class cif::compound is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/compound.hpp:295: warning: Member report_missing_compound(std::string_view compound_id) (function) of class cif::compound_factory is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/compound.hpp:297: warning: Member get_report_missing() const (function) of class cif::compound_factory is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/compound.hpp:299: warning: Member set_report_missing(bool report) (function) of class cif::compound_factory is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/compound.hpp:338: warning: Member compound_source(const file &file) (function) of class cif::compound_source is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class cif::matrix_expression is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class matrix_expression< matrix_cofactors< M > > is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class cif::matrix_expression is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class matrix_expression< matrix_fixed< F, M, N > > is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/datablock.hpp:79: warning: Member swap_(datablock &a, datablock &b) noexcept (friend) of class cif::datablock is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class matrix_expression< matrix_matrix_multiplication< M1, M2 > > is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class matrix_expression< matrix_scalar_multiplication< M, T > > is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class matrix_expression< matrix_subtraction< M1, M2 > > is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/category.hpp:91: warning: Member get_key() const noexcept (function) of class cif::missing_key_error is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class cif::matrix_expression is not documented. if++/point.hpp... Generating code for file cif++/row.hpp... Generating code for file cif++/symmetry.hpp... Generating code for file cif++/text.hpp... Generating code for file cif++/utilities.hpp... Generating code for file cif++/validate.hpp... Generating file documentation... Generating docs for file cif++/atom_type.hpp... Generating docs for file cif++/category.hpp... Generating docs for file cif++/compound.hpp... Generating docs for file cif++/condition.hpp... Generating docs for file cif++/datablock.hpp... Generating docs for file cif++/file.hpp... Generating docs for file cif++/format.hpp... Generating docs for file cif++/forward_decl.hpp... Generating docs for file cif++/gzio.hpp... Generating docs for file cif++/item.hpp... Generating docs for file cif++/iterator.hpp... Generating docs for file cif++/matrix.hpp... Generating docs for file cif++/model.hpp... Generating docs for file cif++/parser.hpp... Generating docs for file cif++/pdb.hpp... Generating docs for file cif++/pdb/cif2pdb.hpp... Generating docs for file cif++/pdb/io.hpp... Generating docs for file cif++/pdb/pdb2cif.hpp... Generating docs for file cif++/pdb/tls.hpp... Generating docs for file cif++/point.hpp... Generating docs for file cif++/row.hpp... Generating docs for file cif++/symmetry.hpp... Generating docs for file cif++/text.hpp... Generating docs for file cif++/utilities.hpp... Generating docs for file cif++/validate.hpp... Generating page documentation... Generating docs for page deprecated... Generating group documentation... Generating class documentation... Generating concept documentation... Generating module documentation... Generating namespace documentation... Generating docs for namespace cif Generating docs for compound cif::atom_type_info... Generating docs for compound cif::atom_type_traits... Generating docs for nested compound cif::atom_type_traits::SFData... Generating docs for compound cif::category... Generating docs for nested compound cif::category::key_element_type... Generating docs for compound cif::category_validator... Generating docs for compound cif::cell... Generating docs for compound cif::compound... Generating docs for compound cif::compound_atom... Generating docs for compound cif::compound_bond... Generating docs for compound cif::compound_factory... Generating docs for compound cif::compound_source... Generating docs for compound cif::condition... Generating docs for compound cif::conditional_iterator_proxy... Generating docs for compound cif::crystal... Generating docs for compound cif::datablock... Generating docs for compound cif::duplicate_key_error... Generating docs for compound cif::empty_type... Generating docs for compound cif::ff_charconv... Generating docs for compound cif::file... Generating docs for compound cif::fill_out_streambuf... Generating docs for compound cif::identity_matrix... Generating docs for compound cif::iless... Generating docs for compound cif::item... Generating docs for compound cif::item_alias... Generating docs for compound cif::item_handle... Generating docs for compound cif::item_validator... Generating docs for compound cif::item_value... Generating docs for compound cif::iterator_impl... Generating docs for compound cif::iterator_impl< Category >... Generating docs for compound cif::iterator_impl< Category, T >... Generating docs for compound cif::iterator_proxy... Generating docs for compound cif::key... Generating docs for compound cif::link_validator... Generating docs for compound cif::matrix... Generating docs for compound cif::matrix_cofactors... Generating docs for compound cif::matrix_expression... Generating docs for compound cif::matrix_fixed... Generating docs for compound cif::matrix_matrix_multiplication... Generating docs for compound cif::matrix_scalar_multiplication... Generating docs for compound cif::matrix_subtraction... Generating docs for compound cif::missing_key_error... Generating docs for compound cif::multiple_results_error... Generating docs for compound cif::parse_error... Generating docs for compound cif::parser... Generating docs for compound/build/reproducible-path/libcifpp-9.0.5/include/cif++/item.hpp:253: warning: Member operator<=>(const item &rhs) const =default (function) of class cif::item is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:284: warning: Member item_alias(const std::string &alias_name, const std::string &dictionary, const std::string &version) (function) of struct cif::item_alias is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:291: warning: Member item_alias(const item_alias &)=default (function) of struct cif::item_alias is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:292: warning: Member operator=(const item_alias &)=default (function) of struct cif::item_alias is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class cif::matrix_expression is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class matrix_expression< matrix_cofactors< M > > is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class cif::matrix_expression is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class matrix_expression< matrix_fixed< F, M, N > > is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:618: warning: Member sub_matrix(const M2 &m, int i, int j) (function) of class cif::sub_matrix is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class matrix_expression< sub_matrix< M2 > > is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class matrix_expression< matrix_matrix_multiplication< M1, M2 > > is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class matrix_expression< matrix_scalar_multiplication< M, T > > is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class cif::matrix_expression is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class matrix_expression< matrix_subtraction< M1, M2 > > is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class matrix_expression< symmetric_matrix_fixed< F, M > > is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/category.hpp:91: warning: Member get_key() const noexcept (function) of class cif::missing_key_error is not documented. if++/point.hpp... Generating code for file cif++/row.hpp... Generating code for file cif++/symmetry.hpp... Generating code for file cif++/text.hpp... Generating code for file cif++/utilities.hpp... Generating code for file cif++/validate.hpp... Generating file documentation... Generating docs for file cif++/atom_type.hpp... Generating docs for file cif++/category.hpp... Generating docs for file cif++/compound.hpp... Generating docs for file cif++/condition.hpp... Generating docs for file cif++/datablock.hpp... Generating docs for file cif++/file.hpp... Generating docs for file cif++/format.hpp... Generating docs for file cif++/forward_decl.hpp... Generating docs for file cif++/gzio.hpp... Generating docs for file cif++/item.hpp... Generating docs for file cif++/iterator.hpp... Generating docs for file cif++/matrix.hpp... Generating docs for file cif++/model.hpp... Generating docs for file cif++/parser.hpp... Generating docs for file cif++/pdb.hpp... Generating docs for file cif++/pdb/cif2pdb.hpp... Generating docs for file cif++/pdb/io.hpp... Generating docs for file cif++/pdb/pdb2cif.hpp... Generating docs for file cif++/pdb/tls.hpp... Generating docs for file cif++/point.hpp... Generating docs for file cif++/row.hpp... Generating docs for file cif++/symmetry.hpp... Generating docs for file cif++/text.hpp... Generating docs for file cif++/utilities.hpp... Generating docs for file cif++/validate.hpp... Generating page documentation... Generating docs for page deprecated... Generating group documentation... Generating class documentation... Generating concept documentation... Generating module documentation... Generating namespace documentation... Generating docs for namespace cif Generating docs for compound cif::atom_type_info... Generating docs for compound cif::atom_type_traits... Generating docs for nested compound cif::atom_type_traits::SFData... Generating docs for compound cif::category... Generating docs for nested compound cif::category::key_element_type... Generating docs for compound cif::category_validator... Generating docs for compound cif::cell... Generating docs for compound cif::compound... Generating docs for compound cif::compound_atom... Generating docs for compound cif::compound_bond... Generating docs for compound cif::compound_factory... Generating docs for compound cif::compound_source... Generating docs for compound cif::condition... Generating docs for compound cif::conditional_iterator_proxy... Generating docs for compound cif::crystal... Generating docs for compound cif::datablock... Generating docs for compound cif::duplicate_key_error... Generating docs for compound cif::empty_type... Generating docs for compound cif::ff_charconv... Generating docs for compound cif::file... Generating docs for compound cif::fill_out_streambuf... Generating docs for compound cif::identity_matrix... Generating docs for compound cif::iless... Generating docs for compound cif::item... Generating docs for compound cif::item_alias... Generating docs for compound cif::item_handle... Generating docs for compound cif::item_validator... Generating docs for compound cif::item_value... Generating docs for compound cif::iterator_impl... Generating docs for compound cif::iterator_impl< Category >... Generating docs for compound cif::iterator_impl< Category, T >... Generating docs for compound cif::iterator_proxy... Generating docs for compound cif::key... Generating docs for compound cif::link_validator... Generating docs for compound cif::matrix... Generating docs for compound cif::matrix_cofactors... Generating docs for compound cif::matrix_expression... Generating docs for compound cif::matrix_fixed... Generating docs for compound cif::matrix_matrix_multiplication... Generating docs for compound cif::matrix_scalar_multiplication... Generating docs for compound cif::matrix_subtraction... Generating docs for compound cif::missing_key_error... Generating docs for compound cif::multiple_results_error... Generating docs for compound cif::parse_error... Generating docs for compound cif::parser... Generating docs for compound/build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:259: warning: Member swap(type_validator &a, type_validator &b) (friend) of struct cif::type_validator is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:179: warning: Member validation_exception(validation_error err) (function) of class cif::validation_exception is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:184: warning: Member validation_exception(validation_error err, std::string_view category) (function) of class cif::validation_exception is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:189: warning: Member validation_exception(validation_error err, std::string_view category, std::string_view item) (function) of class cif::validation_exception is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:194: warning: Member validation_exception(std::error_code ec) (function) of class cif::validation_exception is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:196: warning: Member validation_exception(std::error_code ec, std::string_view category) (function) of class cif::validation_exception is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:198: warning: Member validation_exception(std::error_code ec, std::string_view category, std::string_view item) (function) of class cif::validation_exception is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:423: warning: Member validator(const validator &rhs) (function) of class cif::validator is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:431: warning: Member operator=(validator rhs) (function) of class cif::validator is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:437: warning: Member swap(validator &a, validator &b) noexcept (friend) of class cif::validator is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:618: warning: Member sub_matrix(const M2 &m, int i, int j) (function) of class cif::sub_matrix is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class matrix_expression< sub_matrix< M2 > > is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class cif::matrix_expression is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/matrix.hpp:129: warning: Member operator==(const matrix_expression< M2 > &m) const (function) of class matrix_expression< symmetric_matrix_fixed< F, M > > is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/model.hpp:633: warning: Member prev() const (function) of class cif::mm::monomer is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/model.hpp:634: warning: Member next() const (function) of class cif::mm::monomer is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:259: warning: Member swap(type_validator &a, type_validator &b) (friend) of struct cif::type_validator is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:179: warning: Member validation_exception(validation_error err) (function) of class cif::validation_exception is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:184: warning: Member validation_exception(validation_error err, std::string_view category) (function) of class cif::validation_exception is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:189: warning: Member validation_exception(validation_error err, std::string_view category, std::string_view item) (function) of class cif::validation_exception is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:194: warning: Member validation_exception(std::error_code ec) (function) of class cif::validation_exception is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:196: warning: Member validation_exception(std::error_code ec, std::string_view category) (function) of class cif::validation_exception is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:198: warning: Member validation_exception(std::error_code ec, std::string_view category, std::string_view item) (function) of class cif::validation_exception is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:423: warning: Member validator(const validator &rhs) (function) of class cif::validator is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:431: warning: Member operator=(validator rhs) (function) of class cif::validator is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:437: warning: Member swap(validator &a, validator &b) noexcept (friend) of class cif::validator is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/model.hpp:633: warning: Member prev() const (function) of class cif::mm::monomer is not documented. /build/reproducible-path/libcifpp-9.0.5/include/cif++/model.hpp:634: warning: Member next() const (function) of class cif::mm::monomer is not documented. cif::point_type... Generating docs for compound cif::progress_bar... Generating docs for compound cif::quaternion_type... Generating docs for compound cif::row... Generating docs for compound cif::row_handle... Generating docs for compound cif::row_initializer... Generating docs for compound cif::sac_parser... Generating docs for compound cif::space_group... Generating docs for compound cif::spacegroup... Generating docs for compound cif::spherical_dots... Generating docs for compound cif::sub_matrix... Generating docs for compound cif::sym_op... Generating docs for compound cif::symmetric_matrix... Generating docs for compound cif::symmetric_matrix_fixed... Generating docs for compound cif::symop_data... Generating docs for compound cif::symop_datablock... Generating docs for compound cif::transformation... Generating docs for compound cif::type_validator... Generating docs for compound cif::validation_category_impl... Generating docs for compound cif::validation_exception... Generating docs for compound cif::validator... Generating docs for compound cif::validator_factory... Generating docs for concept cif::Numeric... Generating docs for compound cif::colour::detail::coloured_string_t... Generating docs for compound cif::gzio::basic_ifstream... Generating docs for compound cif::gzio::basic_igzip_streambuf... Generating docs for compound cif::gzio::basic_istream... Generating docs for compound cif::gzio::basic_ofstream... Generating docs for compound cif::gzio::basic_ogzip_streambuf... Generating docs for compound cif::gzio::basic_ostream... Generating docs for compound cif::gzio::basic_streambuf... Generating docs for compound cif::mm::atom... Generating docs for compound cif::mm::branch... Generating docs for compound cif::mm::monomer... Generating docs for compound cif::mm::polymer... Generating docs for compound cif::mm::residue... Generating docs for compound cif::mm::structure... Generating docs for compound cif::mm::structure_open_options... Generating docs for compound cif::mm::sugar... Generating graph info page... Generating directory documentation... Generating dependency graph for directory cif++/pdb finalizing index lists... writing tag file... Generating XML output... Generating XML output for class cif::mm::atom Generating XML output for class cif::atom_type_info Generating XML output for class cif::atom_type_traits Generating XML output for class cif::gzio::basic_ifstream Generating XML output for class cif::gzio::basic_igzip_streambuf Generating XML output for class cif::gzio::basic_istream Generating XML output for class cif::gzio::basic_ofstream Generating XML output for class cif::gzio::basic_ogzip_streambuf Generating XML output for class cif::gzio::basic_ostream Generating XML output for class cif::gzio::basic_streambuf Generating XML output for class cif::mm::branch Generating XML output for class cif::category Generating XML output for class cif::category_validator Generating XML output for class cif::cell Generating XML output for class cif::colour::detail::coloured_string_t Generating XML output for class cif::compound Generating XML output for class cif::compound_atom Generating XML output for class cif::compound_bond Generating XML output for class cif::compound_factory Generating XML output for class cif::compound_source Generating XML output for class cif::condition Generating XML output for class cif::conditional_iterator_proxy Generating XML output for class cif::crystal Generating XML output for class cif::datablock Generating XML output for class cif::duplicate_key_error Generating XML output for class cif::empty_type Generating XML output for class cif::ff_charconv Generating XML output for class cif::file Generating XML output for class cif::fill_out_streambuf Generating XML output for class cif::identity_matrix Generating XML output for class cif::iless Generating XML output for class cif::item Generating XML output for class cif::item_alias Generating XML output for class cif::category::item_entry Generating XML output for class cif::item_handle Generating XML output for class cif: cif::point_type... Generating docs for compound cif::progress_bar... Generating docs for compound cif::quaternion_type... Generating docs for compound cif::row... Generating docs for compound cif::row_handle... Generating docs for compound cif::row_initializer... Generating docs for compound cif::sac_parser... Generating docs for compound cif::space_group... Generating docs for compound cif::spacegroup... Generating docs for compound cif::spherical_dots... Generating docs for compound cif::sub_matrix... Generating docs for compound cif::sym_op... Generating docs for compound cif::symmetric_matrix... Generating docs for compound cif::symmetric_matrix_fixed... Generating docs for compound cif::symop_data... Generating docs for compound cif::symop_datablock... Generating docs for compound cif::transformation... Generating docs for compound cif::type_validator... Generating docs for compound cif::validation_category_impl... Generating docs for compound cif::validation_exception... Generating docs for compound cif::validator... Generating docs for compound cif::validator_factory... Generating docs for concept cif::Numeric... Generating docs for compound cif::colour::detail::coloured_string_t... Generating docs for compound cif::gzio::basic_ifstream... Generating docs for compound cif::gzio::basic_igzip_streambuf... Generating docs for compound cif::gzio::basic_istream... Generating docs for compound cif::gzio::basic_ofstream... Generating docs for compound cif::gzio::basic_ogzip_streambuf... Generating docs for compound cif::gzio::basic_ostream... Generating docs for compound cif::gzio::basic_streambuf... Generating docs for compound cif::mm::atom... Generating docs for compound cif::mm::branch... Generating docs for compound cif::mm::monomer... Generating docs for compound cif::mm::polymer... Generating docs for compound cif::mm::residue... Generating docs for compound cif::mm::structure... Generating docs for compound cif::mm::structure_open_options... Generating docs for compound cif::mm::sugar... Generating graph info page... Generating directory documentation... Generating dependency graph for directory cif++/pdb finalizing index lists... writing tag file... Generating XML output... Generating XML output for class cif::mm::atom Generating XML output for class cif::atom_type_info Generating XML output for class cif::atom_type_traits Generating XML output for class cif::gzio::basic_ifstream Generating XML output for class cif::gzio::basic_igzip_streambuf Generating XML output for class cif::gzio::basic_istream Generating XML output for class cif::gzio::basic_ofstream Generating XML output for class cif::gzio::basic_ogzip_streambuf Generating XML output for class cif::gzio::basic_ostream Generating XML output for class cif::gzio::basic_streambuf Generating XML output for class cif::mm::branch Generating XML output for class cif::category Generating XML output for class cif::category_validator Generating XML output for class cif::cell Generating XML output for class cif::colour::detail::coloured_string_t Generating XML output for class cif::compound Generating XML output for class cif::compound_atom Generating XML output for class cif::compound_bond Generating XML output for class cif::compound_factory Generating XML output for class cif::compound_source Generating XML output for class cif::condition Generating XML output for class cif::conditional_iterator_proxy Generating XML output for class cif::crystal Generating XML output for class cif::datablock Generating XML output for class cif::duplicate_key_error Generating XML output for class cif::empty_type Generating XML output for class cif::ff_charconv Generating XML output for class cif::file Generating XML output for class cif::fill_out_streambuf Generating XML output for class cif::identity_matrix Generating XML output for class cif::iless Generating XML output for class cif::item Generating XML output for class cif::item_alias Generating XML output for class cif::category::item_entry Generating XML output for class cif::item_handle Generating XML output for class cif:/build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:401: warning: cif::validator::validator has @param documentation sections but no arguments /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:411: warning: argument 'name' of command @param is not found in the argument list of cif::validator::validator(std::istream &is) /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:401: warning: cif::validator::validator has @param documentation sections but no arguments /build/reproducible-path/libcifpp-9.0.5/include/cif++/validate.hpp:411: warning: argument 'name' of command @param is not found in the argument list of cif::validator::validator(std::istream &is) /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb.hpp:174: warning: argument 'file' of command @param is not found in the argument list of cif::pdb::is_valid_pdbx_file(const file &pdbx_file, std::error_code &ec) /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb.hpp:174: warning: The following parameters of cif::pdb::is_valid_pdbx_file(const file &pdbx_file, std::error_code &ec) are not documented: parameter 'pdbx_file' parameter 'ec' /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb.hpp:192: warning: argument 'file' of command @param is not found in the argument list of cif::pdb::is_valid_pdbx_file(const file &pdbx_file, const validator &v, std::error_code &ec) /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb.hpp:192: warning: The following parameter of cif::pdb::is_valid_pdbx_file(const file &pdbx_file, const validator &v, std::error_code &ec) is not documented: parameter 'pdbx_file' /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb.hpp:174: warning: argument 'file' of command @param is not found in the argument list of cif::pdb::is_valid_pdbx_file(const file &pdbx_file, std::error_code &ec) /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb.hpp:174: warning: The following parameters of cif::pdb::is_valid_pdbx_file(const file &pdbx_file, std::error_code &ec) are not documented: parameter 'pdbx_file' parameter 'ec' /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb.hpp:192: warning: argument 'file' of command @param is not found in the argument list of cif::pdb::is_valid_pdbx_file(const file &pdbx_file, const validator &v, std::error_code &ec) /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb.hpp:192: warning: The following parameter of cif::pdb::is_valid_pdbx_file(const file &pdbx_file, const validator &v, std::error_code &ec) is not documented: parameter 'pdbx_file' :item_validator Generating XML output for class cif::item_value Generating XML output for class cif::iterator_impl Generating XML output for class cif::iterator_impl< Category > Generating XML output for class cif::iterator_impl< Category, T > Generating XML output for class cif::iterator_proxy Generating XML output for class cif::key Generating XML output for class cif::category::key_element_type Generating XML output for class cif::category::link Generating XML output for class cif::link_validator Generating XML output for class cif::matrix Generating XML output for class cif::matrix_cofactors Generating XML output for class cif::matrix_expression Generating XML output for class cif::matrix_fixed Generating XML output for class cif::matrix_matrix_multiplication Generating XML output for class cif::matrix_scalar_multiplication Generating XML output for class cif::matrix_subtraction Generating XML output for class cif::missing_key_error Generating XML output for class cif::mm::monomer Generating XML output for class cif::multiple_results_error Generating XML output for class cif::parse_error Generating XML output for class cif::parser Generating XML output for class cif::point_type Generating XML output for class cif::mm::polymer Generating XML output for class cif::progress_bar Generating XML output for class cif::quaternion_type Generating XML output for class cif::mm::residue Generating XML output for class cif::row Generating XML output for class cif::row_handle Generating XML output for class cif::row_initializer Generating XML output for class cif::sac_parser Generating XML output for class cif::atom_type_traits::SFData Generating XML output for class cif::space_group Generating XML output for class cif::spacegroup Generating XML output for class cif::spherical_dots Generating XML output for class cif::mm::structure Generating XML output for class cif::mm::structure_open_options Generating XML output for class cif::sub_matrix Generating XML output for class cif::mm::sugar Generating XML output for class cif::sym_op Generating XML output for class cif::symmetric_matrix Generating XML output for class cif::symmetric_matrix_fixed Generating XML output for class cif::symop_data Generating XML output for class cif::symop_datablock Generating XML output for class cif::transformation Generating XML output for class cif::type_validator Generating XML output for class cif::validation_category_impl Generating XML output for class cif::validation_exception Generating XML output for class cif::validator Generating XML output for class cif::validator_factory Generating XML output for concept cif::Numeric Generating XML output for namespace cif Generating XML output for namespace cif::colour Generating XML output for namespace cif::colour::detail Generating XML output for namespace cif::detail Generating XML output for namespace cif::gzio Generating XML output for namespace cif::literals Generating XML output for namespace cif::mm Generating XML output for namespace cif::pdb Generating XML output for namespace std Generating XML output for namespace std_experimental Generating XML output for namespace std_experimental::detail Generating XML output for file cif++.hpp Generating XML output for file atom_type.hpp Generating XML output for file category.hpp Generating XML output for file compound.hpp Generating XML output for file condition.hpp Generating XML output for file datablock.hpp Generating XML output for file dictionary_parser.hpp Generating XML output for file exports.hpp Generating XML output for file file.hpp Generating XML output for file format.hpp Generating XML output for file forward_decl.hpp Generating XML output for file gzio.hpp Generating XML output for file item.hpp Generating XML output for file iterator.hpp Generating XML output for file matrix.hpp Generating XML output for file model.hpp Generating XML output for file parser.hpp Generating XML output for file pdb.hpp Generating XML output for file cif2pdb.hpp Generating XML output for file io.hpp Generating XML output for file pdb2cif.hpp Generating XML out:item_validator Generating XML output for class cif::item_value Generating XML output for class cif::iterator_impl Generating XML output for class cif::iterator_impl< Category > Generating XML output for class cif::iterator_impl< Category, T > Generating XML output for class cif::iterator_proxy Generating XML output for class cif::key Generating XML output for class cif::category::key_element_type Generating XML output for class cif::category::link Generating XML output for class cif::link_validator Generating XML output for class cif::matrix Generating XML output for class cif::matrix_cofactors Generating XML output for class cif::matrix_expression Generating XML output for class cif::matrix_fixed Generating XML output for class cif::matrix_matrix_multiplication Generating XML output for class cif::matrix_scalar_multiplication Generating XML output for class cif::matrix_subtraction Generating XML output for class cif::missing_key_error Generating XML output for class cif::mm::monomer Generating XML output for class cif::multiple_results_error Generating XML output for class cif::parse_error Generating XML output for class cif::parser Generating XML output for class cif::point_type Generating XML output for class cif::mm::polymer Generating XML output for class cif::progress_bar Generating XML output for class cif::quaternion_type Generating XML output for class cif::mm::residue Generating XML output for class cif::row Generating XML output for class cif::row_handle Generating XML output for class cif::row_initializer Generating XML output for class cif::sac_parser Generating XML output for class cif::atom_type_traits::SFData Generating XML output for class cif::space_group Generating XML output for class cif::spacegroup Generating XML output for class cif::spherical_dots Generating XML output for class cif::mm::structure Generating XML output for class cif::mm::structure_open_options Generating XML output for class cif::sub_matrix Generating XML output for class cif::mm::sugar Generating XML output for class cif::sym_op Generating XML output for class cif::symmetric_matrix Generating XML output for class cif::symmetric_matrix_fixed Generating XML output for class cif::symop_data Generating XML output for class cif::symop_datablock Generating XML output for class cif::transformation Generating XML output for class cif::type_validator Generating XML output for class cif::validation_category_impl Generating XML output for class cif::validation_exception Generating XML output for class cif::validator Generating XML output for class cif::validator_factory Generating XML output for concept cif::Numeric Generating XML output for namespace cif Generating XML output for namespace cif::colour Generating XML output for namespace cif::colour::detail Generating XML output for namespace cif::detail Generating XML output for namespace cif::gzio Generating XML output for namespace cif::literals Generating XML output for namespace cif::mm Generating XML output for namespace cif::pdb Generating XML output for namespace std Generating XML output for namespace std_experimental Generating XML output for namespace std_experimental::detail Generating XML output for file cif++.hpp Generating XML output for file atom_type.hpp Generating XML output for file category.hpp Generating XML output for file compound.hpp Generating XML output for file condition.hpp Generating XML output for file datablock.hpp Generating XML output for file dictionary_parser.hpp Generating XML output for file exports.hpp Generating XML output for file file.hpp Generating XML output for file format.hpp Generating XML output for file forward_decl.hpp Generating XML output for file gzio.hpp Generating XML output for file item.hpp Generating XML output for file iterator.hpp Generating XML output for file matrix.hpp Generating XML output for file model.hpp Generating XML output for file parser.hpp Generating XML output for file pdb.hpp Generating XML output for file cif2pdb.hpp Generating XML output for file io.hpp Generating XML output for file pdb2cif.hpp Generating XML output for file tls.hpp Generating XML output for file point.hpp Generating XML output for file row.hpp Generating XML output for file symmetry.hpp Generating XML output for file text.hpp Generating XML output for file utilities.hpp Generating XML output for file validate.hpp Generating XML output for page deprecated Generate XML output for dir /build/reproducible-path/libcifpp-9.0.5/include/cif++/ Generate XML output for dir /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb/ Running plantuml with JAVA... Running dot... type lookup cache used 4797/65536 hits=48451 misses=5047 symbol lookup cache used 5080/65536 hits=62866 misses=5080 finished... put for file tls.hpp Generating XML output for file point.hpp Generating XML output for file row.hpp Generating XML output for file symmetry.hpp Generating XML output for file text.hpp Generating XML output for file utilities.hpp Generating XML output for file validate.hpp Generating XML output for page deprecated Generate XML output for dir /build/reproducible-path/libcifpp-9.0.5/include/cif++/ Generate XML output for dir /build/reproducible-path/libcifpp-9.0.5/include/cif++/pdb/ Running plantuml with JAVA... Running dot... type lookup cache used 4797/65536 hits=48451 misses=5047 symbol lookup cache used 5080/65536 hits=62866 misses=5080 finished... [ 18%] Generating documentation with Sphinx make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/docs && /usr/bin/sphinx-build -b html -Dbreathe_projects.libcifpp=/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/docs/xml /build/reproducible-path/libcifpp-9.0.5/docs /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/docs/sphinx [ 18%] Built target Doxygen-libcifpp [ 20%] Building CXX object CMakeFiles/cifpp.dir/src/file.cpp.o /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/file.cpp.o -MF CMakeFiles/cifpp.dir/src/file.cpp.o.d -o CMakeFiles/cifpp.dir/src/file.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/file.cpp Running Sphinx v8.2.3 loading translations [en]... done making output directory... done [ 22%] Building CXX object CMakeFiles/cifpp.dir/src/item.cpp.o /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/item.cpp.o -MF CMakeFiles/cifpp.dir/src/item.cpp.o.d -o CMakeFiles/cifpp.dir/src/item.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/item.cpp [ 25%] Building CXX object CMakeFiles/cifpp.dir/src/parser.cpp.o /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/parser.cpp.o -MF CMakeFiles/cifpp.dir/src/parser.cpp.o.d -o CMakeFiles/cifpp.dir/src/parser.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/parser.cpp [ 27%] Building CXX object CMakeFiles/cifpp.dir/src/row.cpp.o /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/row.cpp.o -MF CMakeFiles/cifpp.dir/src/row.cpp.o.d -o CMakeFiles/cifpp.dir/src/row.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/row.cpp [ 29%] Building CXX object CMakeFiles/cifpp.dir/src/validate.cpp.o /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/validate.cpp.o -MF CMakeFiles/cifpp.dir/src/validate.cpp.o.d -o CMakeFiles/cifpp.dir/src/validate.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/validate.cpp [ 31%] Building CXX object CMakeFiles/cifpp.dir/src/text.cpp.o /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/text.cpp.o -MF CMakeFiles/cifpp.dir/src/text.cpp.o.d -o CMakeFiles/cifpp.dir/src/text.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/text.cpp (!) Unabridged API: unexpected kind 'concept' (IGNORED) In file included from /usr/include/c++/15/bits/char_traits.h:59, from /usr/include/c++/15/string:44, from /build/reproducible-path/libcifpp-9.0.5/include/cif++/forward_decl.hpp:29, from /build/reproducible-path/libcifpp-9.0.5/include/cif++/item.hpp:30, from /build/reproducible-path/libcifpp-9.0.5/include/cif++/row.hpp:29, from /build/reproducible-path/libcifpp-9.0.5/include/cif++/condition.hpp:29, from /build/reproducible-path/libcifpp-9.0.5/src/dictionary_parser.cpp:27: In function ‘constexpr _Tp* std::construct_at(_Tp*, _Args&& ...) [with _Tp = cif::detail::condition_impl*; _Args = {cif::detail::condition_impl*}]’, inlined from ‘static constexpr void std::allocator_traits >::construct(allocator_type&, _Up*, _Args&& ...) [with _Up = cif::detail::condition_impl*; _Args = {cif::detail::condition_impl*}; _Tp = cif::detail::condition_impl*]’ at /usr/include/c++/15/bits/alloc_traits.h:676:21, inlined from ‘constexpr std::vector<_Tp, _Alloc>::reference std::vector<_Tp, _Alloc>::emplace_back(_Args&& ...) [with _Args = {cif::detail::condition_impl*}; _Tp = cif::detail::condition_impl*; _Alloc = std::allocator]’ at /usr/include/c++/15/bits/vector.tcc:117:30, inlined from ‘cif::detail::and_condition_impl::and_condition_impl(cif::condition&&, cif::condition&&)’ at /build/reproducible-path/libcifpp-9.0.5/include/cif++/condition.hpp:740:23, inlined from ‘cif::condition cif::operator&&(condition&&, condition&&)’ at /build/reproducible-path/libcifpp-9.0.5/include/cif++/condition.hpp:940:77, inlined from ‘void cif::dictionary_parser::link_items()’ at /build/reproducible-path/libcifpp-9.0.5/src/dictionary_parser.cpp:406:110: /usr/include/c++/15/bits/stl_construct.h:110:16: warning: array subscript 0 is outside array bounds of ‘cif::detail::condition_impl* [0]’ [-Warray-bounds=] 110 | return ::new(__loc) _Tp(std::forward<_Args>(__args)...); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ In member function ‘void cif::dictionary_parser::link_items()’: cc1plus: note: source object is likely at address zero [~] Exhale: parsing Doxygen XML. [+] Exhale: finished parsing Doxygen XML in 2.87 seconds. [~] Exhale: generating reStructuredText documents. [+] Exhale: generated reStructuredText documents in 2.44 seconds. myst v4.0.1: MdParserConfig(commonmark_only=False, gfm_only=False, enable_extensions={'colon_fence'}, disable_syntax=[], all_links_external=False, links_external_new_tab=False, url_schemes=('http', 'https', 'mailto', 'ftp'), ref_domains=None, fence_as_directive=set(), number_code_blocks=[], title_to_header=False, heading_anchors=0, heading_slug_func=None, html_meta={}, footnote_sort=True, footnote_transition=True, words_per_minute=200, substitutions={}, linkify_fuzzy_links=True, dmath_allow_labels=True, dmath_allow_space=True, dmath_allow_digits=True, dmath_double_inline=False, update_mathjax=True, mathjax_classes='tex2jax_process|mathjax_process|math|output_area', enable_checkboxes=False, suppress_warnings=[], highlight_code_blocks=True) building [mo]: targets for 0 po files that are out of date writing output... building [html]: targets for 8 source files that are out of date updating environment: [new config] 337 added, 0 changed, 0 removed reading sources... [ 0%] api/classcif_1_1atom__type__traits [ 33%] Building CXX object CMakeFiles/cifpp.dir/src/utilities.cpp.o /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/utilities.cpp.o -MF CMakeFiles/cifpp.dir/src/utilities.cpp.o.d -o CMakeFiles/cifpp.dir/src/utilities.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/utilities.cpp [ 35%] Building CXX object CMakeFiles/cifpp.dir/src/atom_type.cpp.o /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/atom_type.cpp.o -MF CMakeFiles/cifpp.dir/src/atom_type.cpp.o.d -o CMakeFiles/cifpp.dir/src/atom_type.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/atom_type.cpp [ 37%] Building CXX object CMakeFiles/cifpp.dir/src/compound.cpp.o /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/compound.cpp.o -MF CMakeFiles/cifpp.dir/src/compound.cpp.o.d -o CMakeFiles/cifpp.dir/src/compound.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/compound.cpp reading sources... [ 1%] api/classcif_1_1category reading sources... [ 1%] api/classcif_1_1cell reading sources... [ 1%] api/classcif_1_1compound reading sources... [ 1%] api/classcif_1_1compound__factory reading sources... [ 2%] api/classcif_1_1compound__source reading sources... [ 2%] api/classcif_1_1condition reading sources... [ 2%] api/classcif_1_1conditional__iterator__proxy reading sources... [ 3%] api/classcif_1_1crystal reading sources... [ 3%] api/classcif_1_1datablock reading sources... [ 3%] api/classcif_1_1duplicate__key__error reading sources... [ 4%] api/classcif_1_1file reading sources... [ 4%] api/classcif_1_1fill__out__streambuf reading sources... [ 4%] api/classcif_1_1gzio_1_1basic__ifstream reading sources... [ 4%] api/classcif_1_1gzio_1_1basic__igzip__streambuf reading sources... [ 5%] api/classcif_1_1gzio_1_1basic__istream reading sources... [ 5%] api/classcif_1_1gzio_1_1basic__ofstream [ 39%] Building CXX object CMakeFiles/cifpp.dir/src/point.cpp.o /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/point.cpp.o -MF CMakeFiles/cifpp.dir/src/point.cpp.o.d -o CMakeFiles/cifpp.dir/src/point.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/point.cpp reading sources... [ 5%] api/classcif_1_1gzio_1_1basic__ogzip__streambuf reading sources... [ 6%] api/classcif_1_1gzio_1_1basic__ostream reading sources... [ 6%] api/classcif_1_1gzio_1_1basic__streambuf reading sources... [ 6%] api/classcif_1_1identity__matrix reading sources... [ 7%] api/classcif_1_1item reading sources... [ 7%] api/classcif_1_1iterator__impl reading sources... [ 7%] api/classcif_1_1iterator__impl_3_01Category_00_01T_01_4 reading sources... [ 7%] api/classcif_1_1iterator__impl_3_01Category_01_4 reading sources... [ 8%] api/classcif_1_1iterator__proxy reading sources... [ 8%] api/classcif_1_1matrix reading sources... [ 8%] api/classcif_1_1matrix__cofactors reading sources... [ 9%] api/classcif_1_1matrix__expression reading sources... [ 9%] api/classcif_1_1matrix__fixed reading sources... [ 9%] api/classcif_1_1matrix__matrix__multiplication reading sources... [ 9%] api/classcif_1_1matrix__scalar__multiplication reading sources... [ 10%] api/classcif_1_1matrix__subtraction reading sources... [ 10%] api/classcif_1_1missing__key__error [ 41%] Building CXX object CMakeFiles/cifpp.dir/src/symmetry.cpp.o /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/symmetry.cpp.o -MF CMakeFiles/cifpp.dir/src/symmetry.cpp.o.d -o CMakeFiles/cifpp.dir/src/symmetry.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/symmetry.cpp reading sources... [ 10%] api/classcif_1_1mm_1_1atom reading sources... [ 11%] api/classcif_1_1mm_1_1branch reading sources... [ 11%] api/classcif_1_1mm_1_1monomer reading sources... [ 11%] api/classcif_1_1mm_1_1polymer reading sources... [ 12%] api/classcif_1_1mm_1_1residue reading sources... [ 12%] api/classcif_1_1mm_1_1structure [ 43%] Building CXX object CMakeFiles/cifpp.dir/src/model.cpp.o /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/model.cpp.o -MF CMakeFiles/cifpp.dir/src/model.cpp.o.d -o CMakeFiles/cifpp.dir/src/model.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/model.cpp reading sources... [ 12%] api/classcif_1_1mm_1_1sugar reading sources... [ 12%] api/classcif_1_1multiple__results__error reading sources... [ 13%] api/classcif_1_1parse__error reading sources... [ 13%] api/classcif_1_1parser reading sources... [ 13%] api/classcif_1_1progress__bar reading sources... [ 14%] api/classcif_1_1quaternion__type reading sources... [ 14%] api/classcif_1_1row reading sources... [ 14%] api/classcif_1_1row__handle reading sources... [ 15%] api/classcif_1_1row__initializer reading sources... [ 15%] api/classcif_1_1sac__parser reading sources... [ 15%] api/classcif_1_1spacegroup reading sources... [ 15%] api/classcif_1_1spherical__dots reading sources... [ 16%] api/classcif_1_1sub__matrix reading sources... [ 16%] api/classcif_1_1symmetric__matrix reading sources... [ 16%] api/classcif_1_1symmetric__matrix__fixed reading sources... [ 17%] api/classcif_1_1transformation reading sources... [ 17%] api/classcif_1_1validation__category__impl [ 45%] Building CXX object CMakeFiles/cifpp.dir/src/pdb/cif2pdb.cpp.o /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/pdb/cif2pdb.cpp.o -MF CMakeFiles/cifpp.dir/src/pdb/cif2pdb.cpp.o.d -o CMakeFiles/cifpp.dir/src/pdb/cif2pdb.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/pdb/cif2pdb.cpp reading sources... [ 17%] api/classcif_1_1validation__exception reading sources... [ 18%] api/classcif_1_1validator reading sources... [ 18%] api/classcif_1_1validator__factory reading sources... [ 18%] api/define_exports_8hpp_1a34c1ecdfe0e74030d387cc4e3db0f20d reading sources... [ 18%] api/define_exports_8hpp_1a42700069adcc34faeda32076bd173dc1 reading sources... [ 19%] api/define_exports_8hpp_1aab9ff10a498bf7bb72ce703e00c6551c reading sources... [ 19%] api/define_exports_8hpp_1af93831e3c71f1f7a80712cd6b3812992 reading sources... [ 19%] api/define_utilities_8hpp_1abd165ee6474b5b75bf075842fff13a04 reading sources... [ 20%] api/define_utilities_8hpp_1ae2fe1725bb5e9823d089c46b9ed5266e reading sources... [ 20%] api/dir_cif++ reading sources... [ 20%] api/dir_cif++_pdb reading sources... [ 20%] api/enum_model_8hpp_1a6085af7e2c3294d3d5520e387757e8dd reading sources... [ 21%] api/enum_model_8hpp_1a84341c70c74ab432b534a3bac3034dbb reading sources... [ 21%] api/enum_namespacecif_1a22f8e0bb538e176ebddfe89c7ef03a6d reading sources... [ 21%] api/enum_namespacecif_1a339253d4b856d267db110e2e55b6fa46 reading sources... [ 22%] api/enum_namespacecif_1a636b6271c6af17a0d73dbe4557061c03 reading sources... [ 22%] api/enum_namespacecif_1a701ee5c69b8bf4a14c0807d32581e87d reading sources... [ 22%] api/enum_namespacecif_1a9579bd6dc036aa07dcb73e9724cd4f54 reading sources... [ 23%] api/enum_namespacecif_1abd4c1fac9978e10628b9317d386d9287 reading sources... [ 23%] api/enum_namespacecif_1ae5e65dddeeceb84cd55b772eaca216c7 reading sources... [ 23%] api/enum_namespacecif_1aeffd144259eee54425fd70df1a4c119a reading sources... [ 23%] api/enum_utilities_8hpp_1a2dfb81ba6ea862bc2483f1fed3477dcf reading sources... [ 24%] api/enum_utilities_8hpp_1a8fd997c36131df71885f44abf2297523 reading sources... [ 24%] api/file_cif++.hpp reading sources... [ 24%] api/file_cif++_atom_type.hpp reading sources... [ 25%] api/file_cif++_category.hpp reading sources... [ 25%] api/file_cif++_compound.hpp reading sources... [ 25%] api/file_cif++_condition.hpp reading sources... [ 26%] api/file_cif++_datablock.hpp reading sources... [ 26%] api/file_cif++_dictionary_parser.hpp reading sources... [ 26%] api/file_cif++_exports.hpp reading sources... [ 26%] api/file_cif++_file.hpp reading sources... [ 27%] api/file_cif++_format.hpp reading sources... [ 27%] api/file_cif++_forward_decl.hpp reading sources... [ 27%] api/file_cif++_gzio.hpp reading sources... [ 28%] api/file_cif++_item.hpp reading sources... [ 28%] api/file_cif++_iterator.hpp reading sources... [ 28%] api/file_cif++_matrix.hpp reading sources... [ 28%] api/file_cif++_model.hpp reading sources... [ 29%] api/file_cif++_parser.hpp reading sources... [ 29%] api/file_cif++_pdb.hpp reading sources... [ 29%] api/file_cif++_pdb_cif2pdb.hpp reading sources... [ 30%] api/file_cif++_pdb_io.hpp reading sources... [ 30%] api/file_cif++_pdb_pdb2cif.hpp reading sources... [ 30%] api/file_cif++_pdb_tls.hpp reading sources... [ 31%] api/file_cif++_point.hpp reading sources... [ 31%] api/file_cif++_row.hpp reading sources... [ 31%] api/file_cif++_symmetry.hpp reading sources... [ 31%] api/file_cif++_text.hpp reading sources... [ 32%] api/file_cif++_utilities.hpp reading sources... [ 32%] api/file_cif++_validate.hpp [ 47%] Building CXX object CMakeFiles/cifpp.dir/src/pdb/pdb2cif.cpp.o /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/pdb/pdb2cif.cpp.o -MF CMakeFiles/cifpp.dir/src/pdb/pdb2cif.cpp.o.d -o CMakeFiles/cifpp.dir/src/pdb/pdb2cif.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/pdb/pdb2cif.cpp reading sources... [ 32%] api/function_condition_8hpp_1ae3fb5e492867225091edeba773f91d39 reading sources... [ 33%] api/function_model_8hpp_1a9bb5822efb054c2979a666d9bfc0913d reading sources... [ 33%] api/function_model_8hpp_1aaaea875b497445410924763ba322f0f4 reading sources... [ 33%] api/function_model_8hpp_1ab82fb33002132ca78f0f0de0855a9883 reading sources... [ 34%] api/function_namespacecif_1a00df2cb74b5f9590f7f3e4d64ed08077 reading sources... [ 34%] api/function_namespacecif_1a016b23e15d2a1d5f8121a697d7bec68e reading sources... [ 34%] api/function_namespacecif_1a02741e5ba23265cacfda366089d13f00 reading sources... [ 34%] api/function_namespacecif_1a04692e2c6a26c3dd823891c93aa68c46 reading sources... [ 35%] api/function_namespacecif_1a07568e2424a8b9f3d87c0e7b506f01c8 reading sources... [ 35%] api/function_namespacecif_1a07b180b747ac558694dfb1e73503dc71 reading sources... [ 35%] api/function_namespacecif_1a0987fe676d4bf9554de808bfe9b13a6b reading sources... [ 36%] api/function_namespacecif_1a0cf4d792e3cf8fb29aa18b8c585b1426 reading sources... [ 36%] api/function_namespacecif_1a0e173ffb184bab07d483866b6f2f7274 reading sources... [ 36%] api/function_namespacecif_1a0f6dd8dc18df398b116c0c2343c2cfee reading sources... [ 36%] api/function_namespacecif_1a1020ee51b50043210b5e9c8eaecd4c28 reading sources... [ 37%] api/function_namespacecif_1a10ff1c475902516ebcd1cf4059ac513b reading sources... [ 37%] api/function_namespacecif_1a1425b605f99bf04eeb638f55c0d91566 reading sources... [ 37%] api/function_namespacecif_1a15ce5665ae421c0a3db9fac68c149836 reading sources... [ 38%] api/function_namespacecif_1a17188febf04153361cad42eb042da64a reading sources... [ 38%] api/function_namespacecif_1a18461202bb0b0d4d134bc3eb46455776 reading sources... [ 38%] api/function_namespacecif_1a1bf743b12f5bba28eab81d100fa6be6f reading sources... [ 39%] api/function_namespacecif_1a1cb6fb0735b49d0e7796d223763718e4 reading sources... [ 39%] api/function_namespacecif_1a2190ac2315339dabb5be80f2a8634e29 reading sources... [ 39%] api/function_namespacecif_1a23c62f901e53b06d736b955cbb079336 reading sources... [ 39%] api/function_namespacecif_1a26cac7b3c044dff1bdcac52425e775f9 reading sources... [ 40%] api/function_namespacecif_1a27048ca516d6ab9d61b330b3ae27b37f reading sources... [ 40%] api/function_namespacecif_1a277d04e4939dd9a5167dc90c21c00266 reading sources... [ 40%] api/function_namespacecif_1a28d3d6db55465d265cb5b6a7a7d93a6b [ 50%] Building CXX object CMakeFiles/cifpp.dir/src/pdb/pdb2cif_remark_3.cpp.o reading sources... [ 41%] api/function_namespacecif_1a2996a300e6f91f05abb11706b3c3cef2 /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/pdb/pdb2cif_remark_3.cpp.o -MF CMakeFiles/cifpp.dir/src/pdb/pdb2cif_remark_3.cpp.o.d -o CMakeFiles/cifpp.dir/src/pdb/pdb2cif_remark_3.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/pdb/pdb2cif_remark_3.cpp reading sources... [ 41%] api/function_namespacecif_1a2a94aaedfb605f4e6a403e8790ee4cfd reading sources... [ 41%] api/function_namespacecif_1a2b6f06460cea1b44770b316c8c5d4b06 reading sources... [ 42%] api/function_namespacecif_1a2bce0a62772ef8e6c5128b36d4cbb9ce reading sources... [ 42%] api/function_namespacecif_1a2db5caf5ac5cd4376f29255fa9eebbc0 reading sources... [ 42%] api/function_namespacecif_1a2e9af2d268ca7932d3b5df430dfabfe7 reading sources... [ 42%] api/function_namespacecif_1a302fdd5a6fea6ea6a874f4e635bd43e3 reading sources... [ 43%] api/function_namespacecif_1a31bf31f1feff330b402ab96d51b4f458 reading sources... [ 43%] api/function_namespacecif_1a337647d2ca82951e159b244e0a892f0e reading sources... [ 43%] api/function_namespacecif_1a39ae1da888a5c8a6ee7f1438b78b7734 reading sources... [ 44%] api/function_namespacecif_1a3f5264d06e1b2326aadfae8b3b114414 reading sources... [ 44%] api/function_namespacecif_1a3fa150213a7a95d9d013b5faeae2d5f2 reading sources... [ 44%] api/function_namespacecif_1a444f4493c315230d1137f13d0e28920c reading sources... [ 45%] api/function_namespacecif_1a449c5d43d72a9779d3338c2882d13e36 reading sources... [ 45%] api/function_namespacecif_1a470ad3905a4aa5fe52da998640740ab7 reading sources... [ 45%] api/function_namespacecif_1a490147eab255051c58bc3d7d16471e17 reading sources... [ 45%] api/function_namespacecif_1a4c27e27d4cb70a2e13cf2efb05ccd325 reading sources... [ 46%] api/function_namespacecif_1a4c9bbe02598ccb179023f7d9ed18f4e9 reading sources... [ 46%] api/function_namespacecif_1a4da118af7b65801fd61c48356e67e4a1 reading sources... [ 46%] api/function_namespacecif_1a4f2dd5c988ef77316bb4fdda57146fd5 reading sources... [ 47%] api/function_namespacecif_1a52c1d908e7a659686a16cbde3684f7a1 reading sources... [ 47%] api/function_namespacecif_1a561da00d019d125f7356b8717771b6b6 reading sources... [ 47%] api/function_namespacecif_1a57a7530364c9dfa84f8607824e6d70e3 reading sources... [ 47%] api/function_namespacecif_1a5a94d01c3d87fb157ae322b347129e56 reading sources... [ 48%] api/function_namespacecif_1a5c256bdffd9190e69c087e64b69d786d reading sources... [ 48%] api/function_namespacecif_1a643804a021f65a34aa75f121f3023104 reading sources... [ 48%] api/function_namespacecif_1a65ac1856b4a8a6675e6a0f0d9b5edfaa reading sources... [ 49%] api/function_namespacecif_1a674345a2d0fb9af13bea9c833076cec0 reading sources... [ 49%] api/function_namespacecif_1a7555a1d6c76bc1cef206fab9a8d67fad reading sources... [ 49%] api/function_namespacecif_1a75df878566a514b909141bad937280f4 reading sources... [ 50%] api/function_namespacecif_1a7b0b6dec945a1157aa9d455fd35494df reading sources... [ 50%] api/function_namespacecif_1a7da448991e41eef2fa6dbf113827f958 reading sources... [ 50%] api/function_namespacecif_1a867dc9c21324a3e65a931bb4d7160a9e reading sources... [ 50%] api/function_namespacecif_1a86caa43dc2def46857ab3eb037b63f2b reading sources... [ 51%] api/function_namespacecif_1a8864838e9763e207066cdbb217920f21 reading sources... [ 51%] api/function_namespacecif_1a89f948a7392e875f87012ca961060cb3 reading sources... [ 51%] api/function_namespacecif_1a8c224d1a874aab66b434422f03ed85d4 reading sources... [ 52%] api/function_namespacecif_1a8c495f22c9ff90161b1ae539552e02aa reading sources... [ 52%] api/function_namespacecif_1a8c894208d05a89ca79ed66421d241f0f reading sources... [ 52%] api/function_namespacecif_1a8f9736ac0d35666ef1a68f02705b8507 reading sources... [ 53%] api/function_namespacecif_1a94db0d39a3d82bde5ae35a2d5a729dce reading sources... [ 53%] api/function_namespacecif_1a96cecd643b7fedefcee808419ac8db73 reading sources... [ 53%] api/function_namespacecif_1a9a07496ad027d7f53edeba05b8946d15 reading sources... [ 53%] api/function_namespacecif_1a9a46e6bb8184b5c4b2867e50d4bafd46 reading sources... [ 54%] api/function_namespacecif_1a9dbdac69f3a21d391ece6cc214da3075 reading sources... [ 54%] api/function_namespacecif_1a9de541062d328307198b32e4680ac29b reading sources... [ 54%] api/function_namespacecif_1a9ef12a84362871f9b37c36d526dcdc87 reading sources... [ 55%] api/function_namespacecif_1aa0722da1df2e70c4c68cb1e512978cae reading sources... [ 55%] api/function_namespacecif_1aa629e0bd1ddd07f3ffd7bde1bf0bf0fb reading sources... [ 55%] api/function_namespacecif_1aa697ec53ac311721d137e96508fe6268 reading sources... [ 55%] api/function_namespacecif_1aa6ba3ba2b2b2dcbabee10461e0b8cad3 reading sources... [ 56%] api/function_namespacecif_1aae2f02104c912443c2f40b2647803ccb reading sources... [ 56%] api/function_namespacecif_1aaede7d3ae547f8c18450a83b6bcc42e2 reading sources... [ 56%] api/function_namespacecif_1ab173f10abbd57122dbfd669f30af5509 reading sources... [ 57%] api/function_namespacecif_1ab4b982e1dc64e54d408cf8a9a99a2851 reading sources... [ 57%] api/function_namespacecif_1ab5bf28cddf2fe7bbfe60778c60f9082e reading sources... [ 57%] api/function_namespacecif_1ab80f7d084a897f8654fecdcbe4c598ba reading sources... [ 58%] api/function_namespacecif_1ab91dfb39e9ee43942c5d384f161b97f3 reading sources... [ 58%] api/function_namespacecif_1ab97c8f7af37ad32ee1e96218eef8e0e1 reading sources... [ 58%] api/function_namespacecif_1ab9c1b63f260c9ccc3740971d6ca755c7 reading sources... [ 58%] api/function_namespacecif_1abbc95fb717f14cca92d73ff5ed83c685 reading sources... [ 59%] api/function_namespacecif_1abce4bb85397326d1c0a079f43048fa18 reading sources... [ 59%] api/function_namespacecif_1ac0219abe114a15fecf35b9305c6a51b9 reading sources... [ 59%] api/function_namespacecif_1ac0f43cdcc8b1ba95aae5fa92f623993d reading sources... [ 60%] api/function_namespacecif_1ac29c380eff41208bca6fce85b26cbb0b reading sources... [ 60%] api/function_namespacecif_1ac3d9a984c107208b0abbabe5f9e05289 reading sources... [ 60%] api/function_namespacecif_1ac4c468df4c799fd242842a86e523bc3e reading sources... [ 61%] api/function_namespacecif_1acb24b83a370551b91948baf851bc3ba4 reading sources... [ 61%] api/function_namespacecif_1acc0e956a0d6382e85c6ecb631e2edd21 reading sources... [ 61%] api/function_namespacecif_1acde0f42396a36ed1d56f59e8754968b9 reading sources... [ 61%] api/function_namespacecif_1ad0c5beb6c8ad7621c2ec415432b33c48 reading sources... [ 62%] api/function_namespacecif_1ad3654e07e2f3102ac503499fa51d930f reading sources... [ 62%] api/function_namespacecif_1ad57ceedd9a74df6a781247532781c5fa reading sources... [ 62%] api/function_namespacecif_1ad6daf4b6c782edbfeb0236e71f9e6ae1 reading sources... [ 63%] api/function_namespacecif_1ad8a62060b4918e8fcdba571adcde4295 reading sources... [ 63%] api/function_namespacecif_1adecaf77ddb0b38da346fecf70b5df2e0 reading sources... [ 63%] api/function_namespacecif_1ae025ebbaf906da6b0e66d3fa6657c536 reading sources... [ 64%] api/function_namespacecif_1ae338b65793c18872e8bcdfe6a534c83b reading sources... [ 64%] api/function_namespacecif_1ae8f1330ded658c851bda5859f2e071bc reading sources... [ 64%] api/function_namespacecif_1aeb2069c34c7d86acc4418d3740adf5d8 reading sources... [ 64%] api/function_namespacecif_1aeb28b4b173153589179f4f7b5d20c063 reading sources... [ 65%] api/function_namespacecif_1aee7c4c79e259a8c70f8534f1ce3e39a5 reading sources... [ 65%] api/function_namespacecif_1af443771f125de0bdc78726a4235fc1a3 reading sources... [ 65%] api/function_namespacecif_1af6e09fd9a34540b7718e7f76a0029629 reading sources... [ 66%] api/function_namespacecif_1afdee9d0ba328b6dc1219e83b128b003b reading sources... [ 66%] api/function_pdb_8hpp_1a022f50570f0370ddce514869b65fb6ae reading sources... [ 66%] api/function_pdb_8hpp_1a0ca52e86fd5c866cb07ee1d2bd6e0be6 reading sources... [ 66%] api/function_pdb_8hpp_1a0cdfe208e415aa2b34e1277e5de112cb reading sources... [ 67%] api/function_pdb_8hpp_1a0d8dcb296d80df362a6d47d62b9e01c9 reading sources... [ 67%] api/function_pdb_8hpp_1a2bcb3bdc779f63c96a1eb84e45ff4c20 reading sources... [ 67%] api/function_pdb_8hpp_1a346afa86961c301f1d4fa6486584e7c7 reading sources... [ 68%] api/function_pdb_8hpp_1a3beb1e1704887c34c3ffcf62ba4c93a2 reading sources... [ 68%] api/function_pdb_8hpp_1a429736e305a06f11b86700d76f8b1ac3 reading sources... [ 68%] api/function_pdb_8hpp_1a5f015134e46f13c6ef9eb9ed84b66d1a reading sources... [ 69%] api/function_pdb_8hpp_1a631597613cf60653370f704184d3b9d7 reading sources... [ 69%] api/function_pdb_8hpp_1a8442a8beb3ec3862b1223091ba279b3f reading sources... [ 69%] api/function_pdb_8hpp_1a965679d61a80ce38487bb63eb1759281 reading sources... [ 69%] api/function_pdb_8hpp_1aa0d4c3ad5c58499e9cf38a4dd42d11d1 reading sources... [ 70%] api/function_pdb_8hpp_1aa1addf5082e01849dc7b0af93aa0d34d reading sources... [ 70%] api/function_pdb_8hpp_1aa57fd6d1c296ee70c9784fc59382d7c1 reading sources... [ 70%] api/function_pdb_8hpp_1aae0b184e743aa515b75da7b3c494b8ee reading sources... [ 71%] api/function_pdb_8hpp_1ac681cb3a6237bc71dcba0e88fb1c0832 reading sources... [ 71%] api/function_pdb_8hpp_1affa360f702ea4f0811f02b87211294c0 reading sources... [ 71%] api/function_symmetry_8hpp_1a5a53cac9d72c839c804fd7619f764d67 reading sources... [ 72%] api/library_root reading sources... [ 72%] api/namespace_cif reading sources... [ 72%] api/namespace_cif__colour reading sources... [ 72%] api/namespace_cif__colour__detail reading sources... [ 73%] api/namespace_cif__detail reading sources... [ 73%] api/namespace_cif__gzio reading sources... [ 73%] api/namespace_cif__literals reading sources... [ 74%] api/namespace_cif__mm reading sources... [ 74%] api/namespace_cif__pdb reading sources... [ 74%] api/page_deprecated reading sources... [ 74%] api/program_listing_file_cif++.hpp reading sources... [ 75%] api/program_listing_file_cif++_atom_type.hpp reading sources... [ 75%] api/program_listing_file_cif++_category.hpp reading sources... [ 75%] api/program_listing_file_cif++_compound.hpp reading sources... [ 76%] api/program_listing_file_cif++_condition.hpp reading sources... [ 76%] api/program_listing_file_cif++_datablock.hpp reading sources... [ 76%] api/program_listing_file_cif++_dictionary_parser.hpp reading sources... [ 77%] api/program_listing_file_cif++_exports.hpp reading sources... [ 77%] api/program_listing_file_cif++_file.hpp reading sources... [ 77%] api/program_listing_file_cif++_format.hpp reading sources... [ 77%] api/program_listing_file_cif++_forward_decl.hpp reading sources... [ 78%] api/program_listing_file_cif++_gzio.hpp reading sources... [ 78%] api/program_listing_file_cif++_item.hpp reading sources... [ 78%] api/program_listing_file_cif++_iterator.hpp reading sources... [ 79%] api/program_listing_file_cif++_matrix.hpp reading sources... [ 79%] api/program_listing_file_cif++_model.hpp reading sources... [ 79%] api/program_listing_file_cif++_parser.hpp reading sources... [ 80%] api/program_listing_file_cif++_pdb.hpp reading sources... [ 80%] api/program_listing_file_cif++_pdb_cif2pdb.hpp reading sources... [ 80%] api/program_listing_file_cif++_pdb_io.hpp reading sources... [ 80%] api/program_listing_file_cif++_pdb_pdb2cif.hpp reading sources... [ 81%] api/program_listing_file_cif++_pdb_tls.hpp reading sources... [ 81%] api/program_listing_file_cif++_point.hpp reading sources... [ 81%] api/program_listing_file_cif++_row.hpp reading sources... [ 82%] api/program_listing_file_cif++_symmetry.hpp reading sources... [ 82%] api/program_listing_file_cif++_text.hpp reading sources... [ 82%] api/program_listing_file_cif++_utilities.hpp reading sources... [ 82%] api/program_listing_file_cif++_validate.hpp reading sources... [ 83%] api/structcif_1_1atom__type__info reading sources... [ 83%] api/structcif_1_1atom__type__traits_1_1SFData reading sources... [ 83%] api/structcif_1_1category_1_1item__entry reading sources... [ 84%] api/structcif_1_1category_1_1key__element__type reading sources... [ 84%] api/structcif_1_1category_1_1link reading sources... [ 84%] api/structcif_1_1category__validator reading sources... [ 85%] api/structcif_1_1colour_1_1detail_1_1coloured__string__t reading sources... [ 85%] api/structcif_1_1compound__atom reading sources... [ 85%] api/structcif_1_1compound__bond reading sources... [ 85%] api/structcif_1_1empty__type reading sources... [ 86%] api/structcif_1_1ff__charconv reading sources... [ 86%] api/structcif_1_1iless reading sources... [ 86%] api/structcif_1_1item__alias reading sources... [ 87%] api/structcif_1_1item__handle reading sources... [ 87%] api/structcif_1_1item__validator reading sources... [ 87%] api/structcif_1_1item__value reading sources... [ 88%] api/structcif_1_1key reading sources... [ 88%] api/structcif_1_1link__validator reading sources... [ 88%] api/structcif_1_1mm_1_1structure__open__options reading sources... [ 88%] api/structcif_1_1point__type reading sources... [ 89%] api/structcif_1_1space__group reading sources... [ 89%] api/structcif_1_1sym__op reading sources... [ 89%] api/structcif_1_1symop__data reading sources... [ 90%] api/structcif_1_1symop__datablock reading sources... [ 90%] api/structcif_1_1type__validator reading sources... [ 90%] api/typedef_gzio_8hpp_1a41d20db90846830c07aa1b4052e4d61f reading sources... [ 91%] api/typedef_gzio_8hpp_1a584b8865c9038c4eeba40de7d4a9f1aa reading sources... [ 91%] api/typedef_gzio_8hpp_1a878fb88f8eb9b8c5bde4ed2616dca237 reading sources... [ 91%] api/typedef_namespacecif_1a0d929afa021a00eaa3819005173553b4 reading sources... [ 91%] api/typedef_namespacecif_1a2551a5f548db36f37a54c902a7159580 reading sources... [ 92%] api/typedef_namespacecif_1a35974aa02359ef095b68335a05849c53 reading sources... [ 92%] api/typedef_namespacecif_1a5ae3b948c3296e47bf3ae734cfdca029 reading sources... [ 92%] api/typedef_namespacecif_1a74bfe90596358d194adfab0eb0054b79 reading sources... [ 93%] api/typedef_namespacecif_1a88b677fc53a3f1e8e0f15cdb6dc52cb7 reading sources... [ 93%] api/typedef_namespacecif_1a8dcfa853b7f2c8b6dcc921d0c646ab46 reading sources... [ 93%] api/typedef_namespacecif_1aaca06426423d3d411d330b53965e1b2d reading sources... [ 93%] api/typedef_namespacecif_1ae5965db5577f7f70118a5d976232d966 reading sources... [ 94%] api/unabridged_orphan reading sources... [ 94%] api/variable_gzio_8hpp_1a1cc3c9e961807f24cc997b0fdfbe76a6 reading sources... [ 94%] api/variable_namespacecif_1a1c4c3a9495336c603c5f3d7f77f4dc64 reading sources... [ 95%] api/variable_namespacecif_1a1c875e7bda01246ff90860b7228b89b9 reading sources... [ 95%] api/variable_namespacecif_1a2ac4506e2b83a34ec6cc15a024f9b677 reading sources... [ 95%] api/variable_namespacecif_1a335e9db77e4d400afe98317a0da325f9 reading sources... [ 96%] api/variable_namespacecif_1a481dab6db30774c8562d83bb5182cc7b reading sources... [ 96%] api/variable_namespacecif_1a4d1e6f19e4404091efa6d14e14654e63 reading sources... [ 96%] api/variable_namespacecif_1a54a676462364096110c8178e02693802 reading sources... [ 96%] api/variable_namespacecif_1a6dacacf91cee6e2c246a2334f0fbd607 reading sources... [ 97%] api/variable_namespacecif_1a9347107ebb4ef72dca122c3285453c4f reading sources... [ 97%] api/variable_namespacecif_1a9ebb6f223c638daee2bc1bf285be72c8 reading sources... [ 97%] api/variable_namespacecif_1ac0cd49271cfb2fd68933871ab34217d6 reading sources... [ 98%] api/variable_namespacecif_1aee0d4f8adeaf464b4201156efbb97f73 reading sources... [ 98%] basics reading sources... [ 98%] bitsandpieces reading sources... [ 99%] compound reading sources... [ 99%] genindex reading sources... [ 99%] index reading sources... [ 99%] model reading sources... [100%] resources reading sources... [100%] symmetry /build/reproducible-path/libcifpp-9.0.5/docs/api/classcif_1_1category.rst:29: ERROR: Duplicate ID: "classcif_1_1category_1a6b9a2619807c158dc3558ccb78b5fa43" used by and [docutils] /build/reproducible-path/libcifpp-9.0.5/docs/api/classcif_1_1category.rst:29: WARNING: Duplicate explicit target name: "classcif_1_1category_1a6b9a2619807c158dc3558ccb78b5fa43". [docutils] /build/reproducible-path/libcifpp-9.0.5/docs/api/classcif_1_1compound__factory.rst:13: WARNING: Too many template argument lists compared to parameter lists. Argument lists: 1, Parameter lists: 0, Extra empty parameters lists prepended: 1. Declaration: std::map /build/reproducible-path/libcifpp-9.0.5/docs/api/classcif_1_1compound__factory.rst:13: WARNING: Invalid C++ declaration: Expected end of definition. [error at 56] static CIFPP_EXPORT const std::map< std::string, char > kAAMap --------------------------------------------------------^ /build/reproducible-path/libcifpp-9.0.5/docs/api/classcif_1_1compound__factory.rst:13: WARNING: Too many template argument lists compared to parameter lists. Argument lists: 1, Parameter lists: 0, Extra empty parameters lists prepended: 1. Declaration: std::map /build/reproducible-path/libcifpp-9.0.5/docs/api/classcif_1_1compound__factory.rst:13: WARNING: Invalid C++ declaration: Expected end of definition. [error at 56] static CIFPP_EXPORT const std::map< std::string, char > kBaseMap --------------------------------------------------------^ /build/reproducible-path/libcifpp-9.0.5/docs/api/classcif_1_1item.rst:17: ERROR: Duplicate ID: "classcif_1_1item_1a9d2715a6ceae7dd2b5f60a60bcf2d6da" used by and [docutils] /build/reproducible-path/libcifpp-9.0.5/docs/api/classcif_1_1item.rst:17: WARNING: Duplicate explicit target name: "classcif_1_1item_1a9d2715a6ceae7dd2b5f60a60bcf2d6da". [docutils] /build/reproducible-path/libcifpp-9.0.5/docs/api/classcif_1_1item.rst:17: ERROR: Duplicate ID: "classcif_1_1item_1a9d2715a6ceae7dd2b5f60a60bcf2d6da" used by and [docutils] /build/reproducible-path/libcifpp-9.0.5/docs/api/classcif_1_1item.rst:17: WARNING: Duplicate explicit target name: "classcif_1_1item_1a9d2715a6ceae7dd2b5f60a60bcf2d6da". [docutils] /build/reproducible-path/libcifpp-9.0.5/docs/api/file_cif++_condition.hpp.rst:31: WARNING: Inline interpreted text or phrase reference start-string without end-string. [docutils] /build/reproducible-path/libcifpp-9.0.5/docs/api/file_cif++_condition.hpp.rst:31: WARNING: Inline interpreted text or phrase reference start-string without end-string. [docutils] /build/reproducible-path/libcifpp-9.0.5/docs/api/file_cif++_condition.hpp.rst:38: WARNING: Inline interpreted text or phrase reference start-string without end-string. [docutils] /build/reproducible-path/libcifpp-9.0.5/docs/api/file_cif++_condition.hpp.rst:63: WARNING: Inline interpreted text or phrase reference start-string without end-string. [docutils] /build/reproducible-path/libcifpp-9.0.5/docs/api/file_cif++_row.hpp.rst:31: WARNING: Inline interpreted text or phrase reference start-string without end-string. [docutils] /build/reproducible-path/libcifpp-9.0.5/docs/api/file_cif++_row.hpp.rst:31: WARNING: Inline interpreted text or phrase reference start-string without end-string. [docutils] /build/reproducible-path/libcifpp-9.0.5/docs/api/file_cif++_row.hpp.rst:47: WARNING: Inline interpreted text or phrase reference start-string without end-string. [docutils] /build/reproducible-path/libcifpp-9.0.5/docs/api/structcif_1_1atom__type__traits_1_1SFData.rst:19: WARNING: Duplicate C++ declaration, also defined at api/classcif_1_1atom__type__traits:23. Declaration is '.. cpp:struct:: cif::atom_type_traits::SFData'. [duplicate_declaration.cpp] /build/reproducible-path/libcifpp-9.0.5/docs/api/structcif_1_1category_1_1key__element__type.rst:19: WARNING: Duplicate C++ declaration, also defined at api/classcif_1_1category:25. Declaration is '.. cpp:struct:: cif::category::key_element_type'. [duplicate_declaration.cpp] /build/reproducible-path/libcifpp-9.0.5/docs/api/structcif_1_1category_1_1key__element__type.rst:19: WARNING: Duplicate C++ declaration, also defined at api/classcif_1_1category:25. Declaration is '.. cpp:member:: std::string name'. [duplicate_declaration.cpp] /build/reproducible-path/libcifpp-9.0.5/docs/api/structcif_1_1category_1_1key__element__type.rst:19: WARNING: Duplicate C++ declaration, also defined at api/classcif_1_1category:25. Declaration is '.. cpp:member:: std::string value'. [duplicate_declaration.cpp] /build/reproducible-path/libcifpp-9.0.5/docs/api/structcif_1_1category_1_1key__element__type.rst:19: WARNING: Duplicate C++ declaration, also defined at api/classcif_1_1category:25. Declaration is '.. cpp:member:: bool may_be_null = false'. [duplicate_declaration.cpp] /build/reproducible-path/libcifpp-9.0.5/docs/api/structcif_1_1item__handle.rst:13: WARNING: Invalid C++ declaration: Expected end of definition. [error at 38] static CIFPP_EXPORT const item_handle s_null_item --------------------------------------^ /build/reproducible-path/libcifpp-9.0.5/docs/api/structcif_1_1item__value.rst:13: WARNING: Error in declarator or parameters-and-qualifiers If pointer to member declarator: Invalid C++ declaration: Expected identifier in nested name. [error at 21] union cif::item_value ---------------------^ If declarator-id: Invalid C++ declaration: Expected identifier in nested name. [error at 21] union cif::item_value ---------------------^ /build/reproducible-path/libcifpp-9.0.5/docs/api/variable_namespacecif_1a1c4c3a9495336c603c5f3d7f77f4dc64.rst:13: WARNING: Invalid C++ declaration: Expected end of definition. [error at 31] CIFPP_EXPORT const space_group cif::kSpaceGroups [] -------------------------------^ /build/reproducible-path/libcifpp-9.0.5/docs/api/variable_namespacecif_1a1c875e7bda01246ff90860b7228b89b9.rst:13: WARNING: Invalid C++ declaration: Expected end of definition. [error at 27] CIFPP_EXPORT const uint8_t cif::kCharToLowerMap [256] ---------------------------^ /build/reproducible-path/libcifpp-9.0.5/docs/api/variable_namespacecif_1a2ac4506e2b83a34ec6cc15a024f9b677.rst:13: WARNING: Invalid C++ declaration: Expected end of definition. [error at 34] CIFPP_EXPORT const atom_type_info cif::kKnownAtoms [] ----------------------------------^ /build/reproducible-path/libcifpp-9.0.5/docs/api/variable_namespacecif_1a335e9db77e4d400afe98317a0da325f9.rst:13: WARNING: Invalid C++ declaration: Expected end of definition. [error at 31] CIFPP_EXPORT const std::size_t cif::kNrOfSpaceGroups -------------------------------^ /build/reproducible-path/libcifpp-9.0.5/docs/api/variable_namespacecif_1a4d1e6f19e4404091efa6d14e14654e63.rst:13: WARNING: Error in declarator or parameters-and-qualifiers If pointer to member declarator: Invalid C++ declaration: Expected identifier in nested name, got keyword: int [error at 16] CIFPP_EXPORT int cif::VERBOSE ----------------^ If declarator-id: Invalid C++ declaration: Expected identifier in nested name, got keyword: int [error at 16] CIFPP_EXPORT int cif::VERBOSE ----------------^ /build/reproducible-path/libcifpp-9.0.5/docs/api/variable_namespacecif_1a9ebb6f223c638daee2bc1bf285be72c8.rst:13: WARNING: Invalid C++ declaration: Expected end of definition. [error at 31] CIFPP_EXPORT const std::size_t cif::kSymopNrTableSize -------------------------------^ /build/reproducible-path/libcifpp-9.0.5/docs/api/variable_namespacecif_1aee0d4f8adeaf464b4201156efbb97f73.rst:13: WARNING: Invalid C++ declaration: Expected end of definition. [error at 35] CIFPP_EXPORT const symop_datablock cif::kSymopNrTable [] -----------------------------------^ /build/reproducible-path/libcifpp-9.0.5/docs/basics.rst:343: WARNING: Explicit markup ends without a blank line; unexpected unindent. [docutils] /build/reproducible-path/libcifpp-9.0.5/docs/symmetry.rst:37: WARNING: Explicit markup ends without a blank line; unexpected unindent. [docutils] looking for now-outdated files... none found pickling environment... done checking consistency... done preparing documents... done copying assets... copying static files... Writing evaluated template result to /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/docs/sphinx/_static/language_data.js Writing evaluated template result to /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/docs/sphinx/_static/documentation_options.js Writing evaluated template result to /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/docs/sphinx/_static/basic.css Writing evaluated template result to /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/docs/sphinx/_static/js/versions.js copying static files: done copying extra files... copying extra files: done copying assets: done writing output... [ 0%] api/classcif_1_1atom__type__traits writing output... [ 1%] api/classcif_1_1category writing output... [ 1%] api/classcif_1_1cell writing output... [ 1%] api/classcif_1_1compound writing output... [ 1%] api/classcif_1_1compound__factory writing output... [ 2%] api/classcif_1_1compound__source writing output... [ 2%] api/classcif_1_1condition writing output... [ 2%] api/classcif_1_1conditional__iterator__proxy writing output... [ 3%] api/classcif_1_1crystal writing output... [ 3%] api/classcif_1_1datablock writing output... [ 3%] api/classcif_1_1duplicate__key__error writing output... [ 4%] api/classcif_1_1file writing output... [ 4%] api/classcif_1_1fill__out__streambuf writing output... [ 4%] api/classcif_1_1gzio_1_1basic__ifstream writing output... [ 4%] api/classcif_1_1gzio_1_1basic__igzip__streambuf writing output... [ 5%] api/classcif_1_1gzio_1_1basic__istream writing output... [ 5%] api/classcif_1_1gzio_1_1basic__ofstream writing output... [ 5%] api/classcif_1_1gzio_1_1basic__ogzip__streambuf writing output... [ 6%] api/classcif_1_1gzio_1_1basic__ostream writing output... [ 6%] api/classcif_1_1gzio_1_1basic__streambuf writing output... [ 6%] api/classcif_1_1identity__matrix writing output... [ 7%] api/classcif_1_1item writing output... [ 7%] api/classcif_1_1iterator__impl writing output... [ 7%] api/classcif_1_1iterator__impl_3_01Category_00_01T_01_4 writing output... [ 7%] api/classcif_1_1iterator__impl_3_01Category_01_4 writing output... [ 8%] api/classcif_1_1iterator__proxy writing output... [ 8%] api/classcif_1_1matrix writing output... [ 8%] api/classcif_1_1matrix__cofactors [ 52%] Building CXX object CMakeFiles/cifpp.dir/src/pdb/reconstruct.cpp.o /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/pdb/reconstruct.cpp.o -MF CMakeFiles/cifpp.dir/src/pdb/reconstruct.cpp.o.d -o CMakeFiles/cifpp.dir/src/pdb/reconstruct.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/pdb/reconstruct.cpp writing output... [ 9%] api/classcif_1_1matrix__expression writing output... [ 9%] api/classcif_1_1matrix__fixed writing output... [ 9%] api/classcif_1_1matrix__matrix__multiplication writing output... [ 9%] api/classcif_1_1matrix__scalar__multiplication writing output... [ 10%] api/classcif_1_1matrix__subtraction writing output... [ 10%] api/classcif_1_1missing__key__error writing output... [ 10%] api/classcif_1_1mm_1_1atom writing output... [ 11%] api/classcif_1_1mm_1_1branch writing output... [ 11%] api/classcif_1_1mm_1_1monomer writing output... [ 11%] api/classcif_1_1mm_1_1polymer writing output... [ 12%] api/classcif_1_1mm_1_1residue writing output... [ 12%] api/classcif_1_1mm_1_1structure writing output... [ 12%] api/classcif_1_1mm_1_1sugar writing output... [ 12%] api/classcif_1_1multiple__results__error writing output... [ 13%] api/classcif_1_1parse__error writing output... [ 13%] api/classcif_1_1parser writing output... [ 13%] api/classcif_1_1progress__bar writing output... [ 14%] api/classcif_1_1quaternion__type writing output... [ 14%] api/classcif_1_1row writing output... [ 14%] api/classcif_1_1row__handle writing output... [ 15%] api/classcif_1_1row__initializer writing output... [ 15%] api/classcif_1_1sac__parser writing output... [ 15%] api/classcif_1_1spacegroup writing output... [ 15%] api/classcif_1_1spherical__dots writing output... [ 16%] api/classcif_1_1sub__matrix writing output... [ 16%] api/classcif_1_1symmetric__matrix writing output... [ 16%] api/classcif_1_1symmetric__matrix__fixed writing output... [ 17%] api/classcif_1_1transformation writing output... [ 17%] api/classcif_1_1validation__category__impl writing output... [ 17%] api/classcif_1_1validation__exception writing output... [ 18%] api/classcif_1_1validator writing output... [ 18%] api/classcif_1_1validator__factory writing output... [ 18%] api/define_exports_8hpp_1a34c1ecdfe0e74030d387cc4e3db0f20d writing output... [ 18%] api/define_exports_8hpp_1a42700069adcc34faeda32076bd173dc1 writing output... [ 19%] api/define_exports_8hpp_1aab9ff10a498bf7bb72ce703e00c6551c writing output... [ 19%] api/define_exports_8hpp_1af93831e3c71f1f7a80712cd6b3812992 writing output... [ 19%] api/define_utilities_8hpp_1abd165ee6474b5b75bf075842fff13a04 writing output... [ 20%] api/define_utilities_8hpp_1ae2fe1725bb5e9823d089c46b9ed5266e writing output... [ 20%] api/dir_cif++ writing output... [ 20%] api/dir_cif++_pdb writing output... [ 20%] api/enum_model_8hpp_1a6085af7e2c3294d3d5520e387757e8dd writing output... [ 21%] api/enum_model_8hpp_1a84341c70c74ab432b534a3bac3034dbb writing output... [ 21%] api/enum_namespacecif_1a22f8e0bb538e176ebddfe89c7ef03a6d writing output... [ 21%] api/enum_namespacecif_1a339253d4b856d267db110e2e55b6fa46 writing output... [ 22%] api/enum_namespacecif_1a636b6271c6af17a0d73dbe4557061c03 [ 54%] Building CXX object CMakeFiles/cifpp.dir/src/pdb/validate-pdbx.cpp.o /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -Dcifpp_EXPORTS -I/build/reproducible-path/libcifpp-9.0.5/include -I/usr/include/eigen3 -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -fPIC -MD -MT CMakeFiles/cifpp.dir/src/pdb/validate-pdbx.cpp.o -MF CMakeFiles/cifpp.dir/src/pdb/validate-pdbx.cpp.o.d -o CMakeFiles/cifpp.dir/src/pdb/validate-pdbx.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/src/pdb/validate-pdbx.cpp writing output... [ 22%] api/enum_namespacecif_1a701ee5c69b8bf4a14c0807d32581e87d writing output... [ 22%] api/enum_namespacecif_1a9579bd6dc036aa07dcb73e9724cd4f54 writing output... [ 23%] api/enum_namespacecif_1abd4c1fac9978e10628b9317d386d9287 writing output... [ 23%] api/enum_namespacecif_1ae5e65dddeeceb84cd55b772eaca216c7 writing output... [ 23%] api/enum_namespacecif_1aeffd144259eee54425fd70df1a4c119a writing output... [ 23%] api/enum_utilities_8hpp_1a2dfb81ba6ea862bc2483f1fed3477dcf writing output... [ 24%] api/enum_utilities_8hpp_1a8fd997c36131df71885f44abf2297523 writing output... [ 24%] api/file_cif++.hpp writing output... [ 24%] api/file_cif++_atom_type.hpp writing output... [ 25%] api/file_cif++_category.hpp writing output... [ 25%] api/file_cif++_compound.hpp writing output... [ 25%] api/file_cif++_condition.hpp writing output... [ 26%] api/file_cif++_datablock.hpp writing output... [ 26%] api/file_cif++_dictionary_parser.hpp writing output... [ 26%] api/file_cif++_exports.hpp writing output... [ 26%] api/file_cif++_file.hpp writing output... [ 27%] api/file_cif++_format.hpp writing output... [ 27%] api/file_cif++_forward_decl.hpp writing output... [ 27%] api/file_cif++_gzio.hpp writing output... [ 28%] api/file_cif++_item.hpp writing output... [ 28%] api/file_cif++_iterator.hpp writing output... [ 28%] api/file_cif++_matrix.hpp writing output... [ 28%] api/file_cif++_model.hpp writing output... [ 29%] api/file_cif++_parser.hpp writing output... [ 29%] api/file_cif++_pdb.hpp writing output... [ 29%] api/file_cif++_pdb_cif2pdb.hpp writing output... [ 30%] api/file_cif++_pdb_io.hpp writing output... [ 30%] api/file_cif++_pdb_pdb2cif.hpp writing output... [ 30%] api/file_cif++_pdb_tls.hpp writing output... [ 31%] api/file_cif++_point.hpp writing output... [ 31%] api/file_cif++_row.hpp writing output... [ 31%] api/file_cif++_symmetry.hpp writing output... [ 31%] api/file_cif++_text.hpp writing output... [ 32%] api/file_cif++_utilities.hpp writing output... [ 32%] api/file_cif++_validate.hpp writing output... [ 32%] api/function_condition_8hpp_1ae3fb5e492867225091edeba773f91d39 writing output... [ 33%] api/function_model_8hpp_1a9bb5822efb054c2979a666d9bfc0913d writing output... [ 33%] api/function_model_8hpp_1aaaea875b497445410924763ba322f0f4 writing output... [ 33%] api/function_model_8hpp_1ab82fb33002132ca78f0f0de0855a9883 writing output... [ 34%] api/function_namespacecif_1a00df2cb74b5f9590f7f3e4d64ed08077 writing output... [ 34%] api/function_namespacecif_1a016b23e15d2a1d5f8121a697d7bec68e writing output... [ 34%] api/function_namespacecif_1a02741e5ba23265cacfda366089d13f00 writing output... [ 34%] api/function_namespacecif_1a04692e2c6a26c3dd823891c93aa68c46 writing output... [ 35%] api/function_namespacecif_1a07568e2424a8b9f3d87c0e7b506f01c8 writing output... [ 35%] api/function_namespacecif_1a07b180b747ac558694dfb1e73503dc71 writing output... [ 35%] api/function_namespacecif_1a0987fe676d4bf9554de808bfe9b13a6b writing output... [ 36%] api/function_namespacecif_1a0cf4d792e3cf8fb29aa18b8c585b1426 writing output... [ 36%] api/function_namespacecif_1a0e173ffb184bab07d483866b6f2f7274 writing output... [ 36%] api/function_namespacecif_1a0f6dd8dc18df398b116c0c2343c2cfee writing output... [ 36%] api/function_namespacecif_1a1020ee51b50043210b5e9c8eaecd4c28 writing output... [ 37%] api/function_namespacecif_1a10ff1c475902516ebcd1cf4059ac513b writing output... [ 37%] api/function_namespacecif_1a1425b605f99bf04eeb638f55c0d91566 writing output... [ 37%] api/function_namespacecif_1a15ce5665ae421c0a3db9fac68c149836 writing output... [ 38%] api/function_namespacecif_1a17188febf04153361cad42eb042da64a writing output... [ 38%] api/function_namespacecif_1a18461202bb0b0d4d134bc3eb46455776 writing output... [ 38%] api/function_namespacecif_1a1bf743b12f5bba28eab81d100fa6be6f writing output... [ 39%] api/function_namespacecif_1a1cb6fb0735b49d0e7796d223763718e4 writing output... [ 39%] api/function_namespacecif_1a2190ac2315339dabb5be80f2a8634e29 writing output... [ 39%] api/function_namespacecif_1a23c62f901e53b06d736b955cbb079336 writing output... [ 39%] api/function_namespacecif_1a26cac7b3c044dff1bdcac52425e775f9 writing output... [ 40%] api/function_namespacecif_1a27048ca516d6ab9d61b330b3ae27b37f writing output... [ 40%] api/function_namespacecif_1a277d04e4939dd9a5167dc90c21c00266 writing output... [ 40%] api/function_namespacecif_1a28d3d6db55465d265cb5b6a7a7d93a6b writing output... [ 41%] api/function_namespacecif_1a2996a300e6f91f05abb11706b3c3cef2 writing output... [ 41%] api/function_namespacecif_1a2a94aaedfb605f4e6a403e8790ee4cfd writing output... [ 41%] api/function_namespacecif_1a2b6f06460cea1b44770b316c8c5d4b06 writing output... [ 42%] api/function_namespacecif_1a2bce0a62772ef8e6c5128b36d4cbb9ce writing output... [ 42%] api/function_namespacecif_1a2db5caf5ac5cd4376f29255fa9eebbc0 writing output... [ 42%] api/function_namespacecif_1a2e9af2d268ca7932d3b5df430dfabfe7 writing output... [ 42%] api/function_namespacecif_1a302fdd5a6fea6ea6a874f4e635bd43e3 writing output... [ 43%] api/function_namespacecif_1a31bf31f1feff330b402ab96d51b4f458 writing output... [ 43%] api/function_namespacecif_1a337647d2ca82951e159b244e0a892f0e writing output... [ 43%] api/function_namespacecif_1a39ae1da888a5c8a6ee7f1438b78b7734 writing output... [ 44%] api/function_namespacecif_1a3f5264d06e1b2326aadfae8b3b114414 writing output... [ 44%] api/function_namespacecif_1a3fa150213a7a95d9d013b5faeae2d5f2 writing output... [ 44%] api/function_namespacecif_1a444f4493c315230d1137f13d0e28920c writing output... [ 45%] api/function_namespacecif_1a449c5d43d72a9779d3338c2882d13e36 writing output... [ 45%] api/function_namespacecif_1a470ad3905a4aa5fe52da998640740ab7 writing output... [ 45%] api/function_namespacecif_1a490147eab255051c58bc3d7d16471e17 writing output... [ 45%] api/function_namespacecif_1a4c27e27d4cb70a2e13cf2efb05ccd325 writing output... [ 46%] api/function_namespacecif_1a4c9bbe02598ccb179023f7d9ed18f4e9 writing output... [ 46%] api/function_namespacecif_1a4da118af7b65801fd61c48356e67e4a1 writing output... [ 46%] api/function_namespacecif_1a4f2dd5c988ef77316bb4fdda57146fd5 writing output... [ 47%] api/function_namespacecif_1a52c1d908e7a659686a16cbde3684f7a1 writing output... [ 47%] api/function_namespacecif_1a561da00d019d125f7356b8717771b6b6 writing output... [ 47%] api/function_namespacecif_1a57a7530364c9dfa84f8607824e6d70e3 writing output... [ 47%] api/function_namespacecif_1a5a94d01c3d87fb157ae322b347129e56 writing output... [ 48%] api/function_namespacecif_1a5c256bdffd9190e69c087e64b69d786d writing output... [ 48%] api/function_namespacecif_1a643804a021f65a34aa75f121f3023104 writing output... [ 48%] api/function_namespacecif_1a65ac1856b4a8a6675e6a0f0d9b5edfaa writing output... [ 49%] api/function_namespacecif_1a674345a2d0fb9af13bea9c833076cec0 writing output... [ 49%] api/function_namespacecif_1a7555a1d6c76bc1cef206fab9a8d67fad writing output... [ 49%] api/function_namespacecif_1a75df878566a514b909141bad937280f4 writing output... [ 50%] api/function_namespacecif_1a7b0b6dec945a1157aa9d455fd35494df writing output... [ 50%] api/function_namespacecif_1a7da448991e41eef2fa6dbf113827f958 writing output... [ 50%] api/function_namespacecif_1a867dc9c21324a3e65a931bb4d7160a9e writing output... [ 50%] api/function_namespacecif_1a86caa43dc2def46857ab3eb037b63f2b writing output... [ 51%] api/function_namespacecif_1a8864838e9763e207066cdbb217920f21 writing output... [ 51%] api/function_namespacecif_1a89f948a7392e875f87012ca961060cb3 writing output... [ 51%] api/function_namespacecif_1a8c224d1a874aab66b434422f03ed85d4 writing output... [ 52%] api/function_namespacecif_1a8c495f22c9ff90161b1ae539552e02aa writing output... [ 52%] api/function_namespacecif_1a8c894208d05a89ca79ed66421d241f0f writing output... [ 52%] api/function_namespacecif_1a8f9736ac0d35666ef1a68f02705b8507 writing output... [ 53%] api/function_namespacecif_1a94db0d39a3d82bde5ae35a2d5a729dce writing output... [ 53%] api/function_namespacecif_1a96cecd643b7fedefcee808419ac8db73 writing output... [ 53%] api/function_namespacecif_1a9a07496ad027d7f53edeba05b8946d15 writing output... [ 53%] api/function_namespacecif_1a9a46e6bb8184b5c4b2867e50d4bafd46 writing output... [ 54%] api/function_namespacecif_1a9dbdac69f3a21d391ece6cc214da3075 writing output... [ 54%] api/function_namespacecif_1a9de541062d328307198b32e4680ac29b writing output... [ 54%] api/function_namespacecif_1a9ef12a84362871f9b37c36d526dcdc87 writing output... [ 55%] api/function_namespacecif_1aa0722da1df2e70c4c68cb1e512978cae writing output... [ 55%] api/function_namespacecif_1aa629e0bd1ddd07f3ffd7bde1bf0bf0fb writing output... [ 55%] api/function_namespacecif_1aa697ec53ac311721d137e96508fe6268 writing output... [ 55%] api/function_namespacecif_1aa6ba3ba2b2b2dcbabee10461e0b8cad3 writing output... [ 56%] api/function_namespacecif_1aae2f02104c912443c2f40b2647803ccb writing output... [ 56%] api/function_namespacecif_1aaede7d3ae547f8c18450a83b6bcc42e2 writing output... [ 56%] api/function_namespacecif_1ab173f10abbd57122dbfd669f30af5509 writing output... [ 57%] api/function_namespacecif_1ab4b982e1dc64e54d408cf8a9a99a2851 writing output... [ 57%] api/function_namespacecif_1ab5bf28cddf2fe7bbfe60778c60f9082e writing output... [ 57%] api/function_namespacecif_1ab80f7d084a897f8654fecdcbe4c598ba writing output... [ 58%] api/function_namespacecif_1ab91dfb39e9ee43942c5d384f161b97f3 writing output... [ 58%] api/function_namespacecif_1ab97c8f7af37ad32ee1e96218eef8e0e1 writing output... [ 58%] api/function_namespacecif_1ab9c1b63f260c9ccc3740971d6ca755c7 writing output... [ 58%] api/function_namespacecif_1abbc95fb717f14cca92d73ff5ed83c685 writing output... [ 59%] api/function_namespacecif_1abce4bb85397326d1c0a079f43048fa18 writing output... [ 59%] api/function_namespacecif_1ac0219abe114a15fecf35b9305c6a51b9 writing output... [ 59%] api/function_namespacecif_1ac0f43cdcc8b1ba95aae5fa92f623993d writing output... [ 60%] api/function_namespacecif_1ac29c380eff41208bca6fce85b26cbb0b writing output... [ 60%] api/function_namespacecif_1ac3d9a984c107208b0abbabe5f9e05289 writing output... [ 60%] api/function_namespacecif_1ac4c468df4c799fd242842a86e523bc3e writing output... [ 61%] api/function_namespacecif_1acb24b83a370551b91948baf851bc3ba4 writing output... [ 61%] api/function_namespacecif_1acc0e956a0d6382e85c6ecb631e2edd21 writing output... [ 61%] api/function_namespacecif_1acde0f42396a36ed1d56f59e8754968b9 writing output... [ 61%] api/function_namespacecif_1ad0c5beb6c8ad7621c2ec415432b33c48 writing output... [ 62%] api/function_namespacecif_1ad3654e07e2f3102ac503499fa51d930f writing output... [ 62%] api/function_namespacecif_1ad57ceedd9a74df6a781247532781c5fa writing output... [ 62%] api/function_namespacecif_1ad6daf4b6c782edbfeb0236e71f9e6ae1 writing output... [ 63%] api/function_namespacecif_1ad8a62060b4918e8fcdba571adcde4295 writing output... [ 63%] api/function_namespacecif_1adecaf77ddb0b38da346fecf70b5df2e0 writing output... [ 63%] api/function_namespacecif_1ae025ebbaf906da6b0e66d3fa6657c536 writing output... [ 64%] api/function_namespacecif_1ae338b65793c18872e8bcdfe6a534c83b writing output... [ 64%] api/function_namespacecif_1ae8f1330ded658c851bda5859f2e071bc writing output... [ 64%] api/function_namespacecif_1aeb2069c34c7d86acc4418d3740adf5d8 writing output... [ 64%] api/function_namespacecif_1aeb28b4b173153589179f4f7b5d20c063 writing output... [ 65%] api/function_namespacecif_1aee7c4c79e259a8c70f8534f1ce3e39a5 writing output... [ 65%] api/function_namespacecif_1af443771f125de0bdc78726a4235fc1a3 writing output... [ 65%] api/function_namespacecif_1af6e09fd9a34540b7718e7f76a0029629 writing output... [ 66%] api/function_namespacecif_1afdee9d0ba328b6dc1219e83b128b003b writing output... [ 66%] api/function_pdb_8hpp_1a022f50570f0370ddce514869b65fb6ae writing output... [ 66%] api/function_pdb_8hpp_1a0ca52e86fd5c866cb07ee1d2bd6e0be6 writing output... [ 66%] api/function_pdb_8hpp_1a0cdfe208e415aa2b34e1277e5de112cb writing output... [ 67%] api/function_pdb_8hpp_1a0d8dcb296d80df362a6d47d62b9e01c9 writing output... [ 67%] api/function_pdb_8hpp_1a2bcb3bdc779f63c96a1eb84e45ff4c20 writing output... [ 67%] api/function_pdb_8hpp_1a346afa86961c301f1d4fa6486584e7c7 writing output... [ 68%] api/function_pdb_8hpp_1a3beb1e1704887c34c3ffcf62ba4c93a2 writing output... [ 68%] api/function_pdb_8hpp_1a429736e305a06f11b86700d76f8b1ac3 writing output... [ 68%] api/function_pdb_8hpp_1a5f015134e46f13c6ef9eb9ed84b66d1a writing output... [ 69%] api/function_pdb_8hpp_1a631597613cf60653370f704184d3b9d7 writing output... [ 69%] api/function_pdb_8hpp_1a8442a8beb3ec3862b1223091ba279b3f writing output... [ 69%] api/function_pdb_8hpp_1a965679d61a80ce38487bb63eb1759281 writing output... [ 69%] api/function_pdb_8hpp_1aa0d4c3ad5c58499e9cf38a4dd42d11d1 writing output... [ 70%] api/function_pdb_8hpp_1aa1addf5082e01849dc7b0af93aa0d34d writing output... [ 70%] api/function_pdb_8hpp_1aa57fd6d1c296ee70c9784fc59382d7c1 writing output... [ 70%] api/function_pdb_8hpp_1aae0b184e743aa515b75da7b3c494b8ee writing output... [ 71%] api/function_pdb_8hpp_1ac681cb3a6237bc71dcba0e88fb1c0832 writing output... [ 71%] api/function_pdb_8hpp_1affa360f702ea4f0811f02b87211294c0 writing output... [ 71%] api/function_symmetry_8hpp_1a5a53cac9d72c839c804fd7619f764d67 writing output... [ 72%] api/library_root writing output... [ 72%] api/namespace_cif writing output... [ 72%] api/namespace_cif__colour writing output... [ 72%] api/namespace_cif__colour__detail writing output... [ 73%] api/namespace_cif__detail writing output... [ 73%] api/namespace_cif__gzio writing output... [ 73%] api/namespace_cif__literals writing output... [ 74%] api/namespace_cif__mm writing output... [ 74%] api/namespace_cif__pdb writing output... [ 74%] api/page_deprecated writing output... [ 74%] api/program_listing_file_cif++.hpp writing output... [ 75%] api/program_listing_file_cif++_atom_type.hpp writing output... [ 75%] api/program_listing_file_cif++_category.hpp writing output... [ 75%] api/program_listing_file_cif++_compound.hpp writing output... [ 76%] api/program_listing_file_cif++_condition.hpp writing output... [ 76%] api/program_listing_file_cif++_datablock.hpp writing output... [ 76%] api/program_listing_file_cif++_dictionary_parser.hpp writing output... [ 77%] api/program_listing_file_cif++_exports.hpp writing output... [ 77%] api/program_listing_file_cif++_file.hpp writing output... [ 77%] api/program_listing_file_cif++_format.hpp writing output... [ 77%] api/program_listing_file_cif++_forward_decl.hpp writing output... [ 78%] api/program_listing_file_cif++_gzio.hpp writing output... [ 78%] api/program_listing_file_cif++_item.hpp writing output... [ 78%] api/program_listing_file_cif++_iterator.hpp writing output... [ 79%] api/program_listing_file_cif++_matrix.hpp writing output... [ 79%] api/program_listing_file_cif++_model.hpp writing output... [ 79%] api/program_listing_file_cif++_parser.hpp writing output... [ 80%] api/program_listing_file_cif++_pdb.hpp writing output... [ 80%] api/program_listing_file_cif++_pdb_cif2pdb.hpp writing output... [ 80%] api/program_listing_file_cif++_pdb_io.hpp writing output... [ 80%] api/program_listing_file_cif++_pdb_pdb2cif.hpp writing output... [ 81%] api/program_listing_file_cif++_pdb_tls.hpp writing output... [ 81%] api/program_listing_file_cif++_point.hpp writing output... [ 81%] api/program_listing_file_cif++_row.hpp writing output... [ 82%] api/program_listing_file_cif++_symmetry.hpp writing output... [ 82%] api/program_listing_file_cif++_text.hpp writing output... [ 82%] api/program_listing_file_cif++_utilities.hpp writing output... [ 82%] api/program_listing_file_cif++_validate.hpp writing output... [ 83%] api/structcif_1_1atom__type__info writing output... [ 83%] api/structcif_1_1atom__type__traits_1_1SFData writing output... [ 83%] api/structcif_1_1category_1_1item__entry writing output... [ 84%] api/structcif_1_1category_1_1key__element__type writing output... [ 84%] api/structcif_1_1category_1_1link writing output... [ 84%] api/structcif_1_1category__validator writing output... [ 85%] api/structcif_1_1colour_1_1detail_1_1coloured__string__t writing output... [ 85%] api/structcif_1_1compound__atom writing output... [ 85%] api/structcif_1_1compound__bond writing output... [ 85%] api/structcif_1_1empty__type writing output... [ 86%] api/structcif_1_1ff__charconv writing output... [ 86%] api/structcif_1_1iless writing output... [ 86%] api/structcif_1_1item__alias writing output... [ 87%] api/structcif_1_1item__handle writing output... [ 87%] api/structcif_1_1item__validator writing output... [ 87%] api/structcif_1_1item__value writing output... [ 88%] api/structcif_1_1key writing output... [ 88%] api/structcif_1_1link__validator writing output... [ 88%] api/structcif_1_1mm_1_1structure__open__options writing output... [ 88%] api/structcif_1_1point__type writing output... [ 89%] api/structcif_1_1space__group writing output... [ 89%] api/structcif_1_1sym__op writing output... [ 89%] api/structcif_1_1symop__data writing output... [ 90%] api/structcif_1_1symop__datablock writing output... [ 90%] api/structcif_1_1type__validator writing output... [ 90%] api/typedef_gzio_8hpp_1a41d20db90846830c07aa1b4052e4d61f writing output... [ 91%] api/typedef_gzio_8hpp_1a584b8865c9038c4eeba40de7d4a9f1aa writing output... [ 91%] api/typedef_gzio_8hpp_1a878fb88f8eb9b8c5bde4ed2616dca237 writing output... [ 91%] api/typedef_namespacecif_1a0d929afa021a00eaa3819005173553b4 writing output... [ 91%] api/typedef_namespacecif_1a2551a5f548db36f37a54c902a7159580 writing output... [ 92%] api/typedef_namespacecif_1a35974aa02359ef095b68335a05849c53 writing output... [ 92%] api/typedef_namespacecif_1a5ae3b948c3296e47bf3ae734cfdca029 writing output... [ 92%] api/typedef_namespacecif_1a74bfe90596358d194adfab0eb0054b79 writing output... [ 93%] api/typedef_namespacecif_1a88b677fc53a3f1e8e0f15cdb6dc52cb7 writing output... [ 93%] api/typedef_namespacecif_1a8dcfa853b7f2c8b6dcc921d0c646ab46 writing output... [ 93%] api/typedef_namespacecif_1aaca06426423d3d411d330b53965e1b2d writing output... [ 93%] api/typedef_namespacecif_1ae5965db5577f7f70118a5d976232d966 writing output... [ 94%] api/unabridged_orphan writing output... [ 94%] api/variable_gzio_8hpp_1a1cc3c9e961807f24cc997b0fdfbe76a6 writing output... [ 94%] api/variable_namespacecif_1a1c4c3a9495336c603c5f3d7f77f4dc64 writing output... [ 95%] api/variable_namespacecif_1a1c875e7bda01246ff90860b7228b89b9 writing output... [ 95%] api/variable_namespacecif_1a2ac4506e2b83a34ec6cc15a024f9b677 writing output... [ 95%] api/variable_namespacecif_1a335e9db77e4d400afe98317a0da325f9 writing output... [ 96%] api/variable_namespacecif_1a481dab6db30774c8562d83bb5182cc7b writing output... [ 96%] api/variable_namespacecif_1a4d1e6f19e4404091efa6d14e14654e63 writing output... [ 96%] api/variable_namespacecif_1a54a676462364096110c8178e02693802 writing output... [ 96%] api/variable_namespacecif_1a6dacacf91cee6e2c246a2334f0fbd607 writing output... [ 97%] api/variable_namespacecif_1a9347107ebb4ef72dca122c3285453c4f writing output... [ 97%] api/variable_namespacecif_1a9ebb6f223c638daee2bc1bf285be72c8 writing output... [ 97%] api/variable_namespacecif_1ac0cd49271cfb2fd68933871ab34217d6 writing output... [ 98%] api/variable_namespacecif_1aee0d4f8adeaf464b4201156efbb97f73 writing output... [ 98%] basics writing output... [ 98%] bitsandpieces writing output... [ 99%] compound writing output... [ 99%] genindex writing output... [ 99%] index writing output... [ 99%] model writing output... [100%] resources writing output... [100%] symmetry /build/reproducible-path/libcifpp-9.0.5/docs/api/classcif_1_1progress__bar.rst:: WARNING: Lexing literal_block 'step 3 ========================-------------------------------- 40% ⢁' as "cpp" resulted in an error at token: '⢁'. Retrying in relaxed mode. [misc.highlighting_failure] /build/reproducible-path/libcifpp-9.0.5/docs/basics.rst:262: WARNING: undefined label: '_atom_site-label' [ref.ref] /build/reproducible-path/libcifpp-9.0.5/docs/basics.rst:272: WARNING: undefined label: 'validation' [ref.ref] /build/reproducible-path/libcifpp-9.0.5/docs/basics.rst:276: WARNING: Pygments lexer name 'cif' is not known [misc.highlighting_failure] /build/reproducible-path/libcifpp-9.0.5/docs/basics.rst:298: WARNING: Pygments lexer name 'cif' is not known [misc.highlighting_failure] /build/reproducible-path/libcifpp-9.0.5/docs/basics.rst:345: WARNING: Pygments lexer name 'cif' is not known [misc.highlighting_failure] /build/reproducible-path/libcifpp-9.0.5/docs/basics.rst:374: WARNING: Pygments lexer name 'cif' is not known [misc.highlighting_failure] /build/reproducible-path/libcifpp-9.0.5/docs/basics.rst:390: WARNING: Pygments lexer name 'cif' is not known [misc.highlighting_failure] /build/reproducible-path/libcifpp-9.0.5/docs/bitsandpieces.rst:11: WARNING: cpp:class targets a type (cif::gzio::ifstream). /build/reproducible-path/libcifpp-9.0.5/docs/bitsandpieces.rst:11: WARNING: cpp:class targets a type (cif::gzio::ofstream). /build/reproducible-path/libcifpp-9.0.5/docs/bitsandpieces.rst:29: WARNING: cpp:class targets a type (cif::gzio::istream). generating indices... genindex done writing additional pages... search done dumping search index in English (code: en)... done dumping object inventory... done build succeeded, 44 warnings. The HTML pages are in sphinx. make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' [ 54%] Built target Sphinx-libcifpp [ 56%] Linking CXX shared library libcifpp.so /usr/bin/cmake -E cmake_link_script CMakeFiles/cifpp.dir/link.txt --verbose=1 /usr/bin/c++ -fPIC -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -Wl,--dependency-file=CMakeFiles/cifpp.dir/link.d -Wl,-z,relro -Wl,-z,now -shared -Wl,-soname,libcifpp.so.9 -o libcifpp.so.9.0.5 CMakeFiles/cifpp.dir/src/category.cpp.o CMakeFiles/cifpp.dir/src/condition.cpp.o CMakeFiles/cifpp.dir/src/datablock.cpp.o CMakeFiles/cifpp.dir/src/dictionary_parser.cpp.o CMakeFiles/cifpp.dir/src/file.cpp.o CMakeFiles/cifpp.dir/src/item.cpp.o CMakeFiles/cifpp.dir/src/parser.cpp.o CMakeFiles/cifpp.dir/src/row.cpp.o CMakeFiles/cifpp.dir/src/validate.cpp.o CMakeFiles/cifpp.dir/src/text.cpp.o CMakeFiles/cifpp.dir/src/utilities.cpp.o CMakeFiles/cifpp.dir/src/atom_type.cpp.o CMakeFiles/cifpp.dir/src/compound.cpp.o CMakeFiles/cifpp.dir/src/point.cpp.o CMakeFiles/cifpp.dir/src/symmetry.cpp.o CMakeFiles/cifpp.dir/src/model.cpp.o CMakeFiles/cifpp.dir/src/pdb/cif2pdb.cpp.o CMakeFiles/cifpp.dir/src/pdb/pdb2cif.cpp.o CMakeFiles/cifpp.dir/src/pdb/pdb2cif_remark_3.cpp.o CMakeFiles/cifpp.dir/src/pdb/reconstruct.cpp.o "CMakeFiles/cifpp.dir/src/pdb/validate-pdbx.cpp.o" /usr/lib/x86_64-linux-gnu/libz.so /usr/lib/x86_64-linux-gnu/libpcre2-8.so /usr/bin/cmake -E cmake_symlink_library libcifpp.so.9.0.5 libcifpp.so.9 libcifpp.so make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' [ 56%] Built target cifpp make -f test/CMakeFiles/test-main.dir/build.make test/CMakeFiles/test-main.dir/depend make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/reproducible-path/libcifpp-9.0.5 /build/reproducible-path/libcifpp-9.0.5/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test/CMakeFiles/test-main.dir/DependInfo.cmake "--color=" make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make -f test/CMakeFiles/test-main.dir/build.make test/CMakeFiles/test-main.dir/build make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' [ 58%] Building CXX object test/CMakeFiles/test-main.dir/test-main.cpp.o cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -I/build/reproducible-path/libcifpp-9.0.5/include -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -MD -MT test/CMakeFiles/test-main.dir/test-main.cpp.o -MF CMakeFiles/test-main.dir/test-main.cpp.o.d -o CMakeFiles/test-main.dir/test-main.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/test/test-main.cpp make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' [ 58%] Built target test-main make -f test/CMakeFiles/unit-v2-test.dir/build.make test/CMakeFiles/unit-v2-test.dir/depend make -f test/CMakeFiles/unit-3d-test.dir/build.make test/CMakeFiles/unit-3d-test.dir/depend make -f test/CMakeFiles/model-test.dir/build.make test/CMakeFiles/model-test.dir/depend make -f test/CMakeFiles/query-test.dir/build.make test/CMakeFiles/query-test.dir/depend make -f test/CMakeFiles/rename-compound-test.dir/build.make test/CMakeFiles/rename-compound-test.dir/depend make -f test/CMakeFiles/sugar-test.dir/build.make test/CMakeFiles/sugar-test.dir/depend make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/reproducible-path/libcifpp-9.0.5 /build/reproducible-path/libcifpp-9.0.5/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test/CMakeFiles/unit-v2-test.dir/DependInfo.cmake "--color=" make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/reproducible-path/libcifpp-9.0.5 /build/reproducible-path/libcifpp-9.0.5/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test/CMakeFiles/unit-3d-test.dir/DependInfo.cmake "--color=" make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/reproducible-path/libcifpp-9.0.5 /build/reproducible-path/libcifpp-9.0.5/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test/CMakeFiles/model-test.dir/DependInfo.cmake "--color=" make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/reproducible-path/libcifpp-9.0.5 /build/reproducible-path/libcifpp-9.0.5/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test/CMakeFiles/query-test.dir/DependInfo.cmake "--color=" make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/reproducible-path/libcifpp-9.0.5 /build/reproducible-path/libcifpp-9.0.5/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test/CMakeFiles/rename-compound-test.dir/DependInfo.cmake "--color=" make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/reproducible-path/libcifpp-9.0.5 /build/reproducible-path/libcifpp-9.0.5/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test/CMakeFiles/sugar-test.dir/DependInfo.cmake "--color=" make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make -f test/CMakeFiles/model-test.dir/build.make test/CMakeFiles/model-test.dir/build make -f test/CMakeFiles/unit-v2-test.dir/build.make test/CMakeFiles/unit-v2-test.dir/build make -f test/CMakeFiles/unit-3d-test.dir/build.make test/CMakeFiles/unit-3d-test.dir/build make -f test/CMakeFiles/query-test.dir/build.make test/CMakeFiles/query-test.dir/build make -f test/CMakeFiles/sugar-test.dir/build.make test/CMakeFiles/sugar-test.dir/build make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make -f test/CMakeFiles/rename-compound-test.dir/build.make test/CMakeFiles/rename-compound-test.dir/build make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' [ 64%] Building CXX object test/CMakeFiles/unit-v2-test.dir/unit-v2-test.cpp.o [ 64%] Building CXX object test/CMakeFiles/unit-3d-test.dir/unit-3d-test.cpp.o [ 64%] Building CXX object test/CMakeFiles/model-test.dir/model-test.cpp.o [ 66%] Building CXX object test/CMakeFiles/query-test.dir/query-test.cpp.o cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -I/usr/include/eigen3 -I/build/reproducible-path/libcifpp-9.0.5/include -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -MD -MT test/CMakeFiles/unit-3d-test.dir/unit-3d-test.cpp.o -MF CMakeFiles/unit-3d-test.dir/unit-3d-test.cpp.o.d -o CMakeFiles/unit-3d-test.dir/unit-3d-test.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/test/unit-3d-test.cpp cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -I/usr/include/eigen3 -I/build/reproducible-path/libcifpp-9.0.5/include -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -MD -MT test/CMakeFiles/unit-v2-test.dir/unit-v2-test.cpp.o -MF CMakeFiles/unit-v2-test.dir/unit-v2-test.cpp.o.d -o CMakeFiles/unit-v2-test.dir/unit-v2-test.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/test/unit-v2-test.cpp cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -I/usr/include/eigen3 -I/build/reproducible-path/libcifpp-9.0.5/include -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -MD -MT test/CMakeFiles/model-test.dir/model-test.cpp.o -MF CMakeFiles/model-test.dir/model-test.cpp.o.d -o CMakeFiles/model-test.dir/model-test.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/test/model-test.cpp cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -I/usr/include/eigen3 -I/build/reproducible-path/libcifpp-9.0.5/include -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -MD -MT test/CMakeFiles/query-test.dir/query-test.cpp.o -MF CMakeFiles/query-test.dir/query-test.cpp.o.d -o CMakeFiles/query-test.dir/query-test.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/test/query-test.cpp [ 68%] Building CXX object test/CMakeFiles/rename-compound-test.dir/rename-compound-test.cpp.o [ 70%] Building CXX object test/CMakeFiles/sugar-test.dir/sugar-test.cpp.o cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -I/usr/include/eigen3 -I/build/reproducible-path/libcifpp-9.0.5/include -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -MD -MT test/CMakeFiles/rename-compound-test.dir/rename-compound-test.cpp.o -MF CMakeFiles/rename-compound-test.dir/rename-compound-test.cpp.o.d -o CMakeFiles/rename-compound-test.dir/rename-compound-test.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/test/rename-compound-test.cpp cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -I/usr/include/eigen3 -I/build/reproducible-path/libcifpp-9.0.5/include -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -MD -MT test/CMakeFiles/sugar-test.dir/sugar-test.cpp.o -MF CMakeFiles/sugar-test.dir/sugar-test.cpp.o.d -o CMakeFiles/sugar-test.dir/sugar-test.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/test/sugar-test.cpp [ 72%] Linking CXX executable rename-compound-test cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/cmake -E cmake_link_script CMakeFiles/rename-compound-test.dir/link.txt --verbose=1 /usr/bin/c++ -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -Wl,-z,relro -Wl,-z,now -Wl,--dependency-file=CMakeFiles/rename-compound-test.dir/link.d "CMakeFiles/rename-compound-test.dir/rename-compound-test.cpp.o" "CMakeFiles/test-main.dir/test-main.cpp.o" -o rename-compound-test -Wl,-rpath,/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu ../libcifpp.so.9.0.5 /usr/lib/libCatch2.a /usr/lib/x86_64-linux-gnu/libz.so make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' [ 72%] Built target rename-compound-test make -f test/CMakeFiles/spinner-test.dir/build.make test/CMakeFiles/spinner-test.dir/depend [ 75%] Linking CXX executable query-test make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/reproducible-path/libcifpp-9.0.5 /build/reproducible-path/libcifpp-9.0.5/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test/CMakeFiles/spinner-test.dir/DependInfo.cmake "--color=" cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/cmake -E cmake_link_script CMakeFiles/query-test.dir/link.txt --verbose=1 make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make -f test/CMakeFiles/spinner-test.dir/build.make test/CMakeFiles/spinner-test.dir/build make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' [ 77%] Building CXX object test/CMakeFiles/spinner-test.dir/spinner-test.cpp.o cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -I/usr/include/eigen3 -I/build/reproducible-path/libcifpp-9.0.5/include -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -MD -MT test/CMakeFiles/spinner-test.dir/spinner-test.cpp.o -MF CMakeFiles/spinner-test.dir/spinner-test.cpp.o.d -o CMakeFiles/spinner-test.dir/spinner-test.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/test/spinner-test.cpp /usr/bin/c++ -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -Wl,-z,relro -Wl,-z,now -Wl,--dependency-file=CMakeFiles/query-test.dir/link.d "CMakeFiles/query-test.dir/query-test.cpp.o" "CMakeFiles/test-main.dir/test-main.cpp.o" -o query-test -Wl,-rpath,/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu ../libcifpp.so.9.0.5 /usr/lib/libCatch2.a /usr/lib/x86_64-linux-gnu/libz.so make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' [ 77%] Built target query-test make -f test/CMakeFiles/reconstruction-test.dir/build.make test/CMakeFiles/reconstruction-test.dir/depend make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/reproducible-path/libcifpp-9.0.5 /build/reproducible-path/libcifpp-9.0.5/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test/CMakeFiles/reconstruction-test.dir/DependInfo.cmake "--color=" make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make -f test/CMakeFiles/reconstruction-test.dir/build.make test/CMakeFiles/reconstruction-test.dir/build make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' [ 79%] Building CXX object test/CMakeFiles/reconstruction-test.dir/reconstruction-test.cpp.o cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -I/usr/include/eigen3 -I/build/reproducible-path/libcifpp-9.0.5/include -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -MD -MT test/CMakeFiles/reconstruction-test.dir/reconstruction-test.cpp.o -MF CMakeFiles/reconstruction-test.dir/reconstruction-test.cpp.o.d -o CMakeFiles/reconstruction-test.dir/reconstruction-test.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/test/reconstruction-test.cpp [ 81%] Linking CXX executable sugar-test cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/cmake -E cmake_link_script CMakeFiles/sugar-test.dir/link.txt --verbose=1 [ 83%] Linking CXX executable unit-v2-test cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/cmake -E cmake_link_script CMakeFiles/unit-v2-test.dir/link.txt --verbose=1 /usr/bin/c++ -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -Wl,-z,relro -Wl,-z,now -Wl,--dependency-file=CMakeFiles/sugar-test.dir/link.d "CMakeFiles/sugar-test.dir/sugar-test.cpp.o" "CMakeFiles/test-main.dir/test-main.cpp.o" -o sugar-test -Wl,-rpath,/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu ../libcifpp.so.9.0.5 /usr/lib/libCatch2.a /usr/lib/x86_64-linux-gnu/libz.so make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' [ 83%] Built target sugar-test make -f test/CMakeFiles/validate-pdbx-test.dir/build.make test/CMakeFiles/validate-pdbx-test.dir/depend make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/reproducible-path/libcifpp-9.0.5 /build/reproducible-path/libcifpp-9.0.5/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test/CMakeFiles/validate-pdbx-test.dir/DependInfo.cmake "--color=" make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make -f test/CMakeFiles/validate-pdbx-test.dir/build.make test/CMakeFiles/validate-pdbx-test.dir/build make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' [ 85%] Building CXX object test/CMakeFiles/validate-pdbx-test.dir/validate-pdbx-test.cpp.o cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -I/usr/include/eigen3 -I/build/reproducible-path/libcifpp-9.0.5/include -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -MD -MT test/CMakeFiles/validate-pdbx-test.dir/validate-pdbx-test.cpp.o -MF CMakeFiles/validate-pdbx-test.dir/validate-pdbx-test.cpp.o.d -o CMakeFiles/validate-pdbx-test.dir/validate-pdbx-test.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/test/validate-pdbx-test.cpp /usr/bin/c++ -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -Wl,-z,relro -Wl,-z,now -Wl,--dependency-file=CMakeFiles/unit-v2-test.dir/link.d "CMakeFiles/unit-v2-test.dir/unit-v2-test.cpp.o" "CMakeFiles/test-main.dir/test-main.cpp.o" -o unit-v2-test -Wl,-rpath,/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu ../libcifpp.so.9.0.5 /usr/lib/libCatch2.a /usr/lib/x86_64-linux-gnu/libz.so make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' [ 85%] Built target unit-v2-test make -f test/CMakeFiles/matrix-test.dir/build.make test/CMakeFiles/matrix-test.dir/depend make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu && /usr/bin/cmake -E cmake_depends "Unix Makefiles" /build/reproducible-path/libcifpp-9.0.5 /build/reproducible-path/libcifpp-9.0.5/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test/CMakeFiles/matrix-test.dir/DependInfo.cmake "--color=" make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make -f test/CMakeFiles/matrix-test.dir/build.make test/CMakeFiles/matrix-test.dir/build make[4]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' [ 87%] Building CXX object test/CMakeFiles/matrix-test.dir/matrix-test.cpp.o cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/c++ -DCACHE_DIR=\"/var/cache/libcifpp\" -DDATA_DIR=\"/usr/share/libcifpp\" -I/usr/include/eigen3 -I/build/reproducible-path/libcifpp-9.0.5/include -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -std=gnu++20 -MD -MT test/CMakeFiles/matrix-test.dir/matrix-test.cpp.o -MF CMakeFiles/matrix-test.dir/matrix-test.cpp.o.d -o CMakeFiles/matrix-test.dir/matrix-test.cpp.o -c /build/reproducible-path/libcifpp-9.0.5/test/matrix-test.cpp [ 89%] Linking CXX executable spinner-test cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/cmake -E cmake_link_script CMakeFiles/spinner-test.dir/link.txt --verbose=1 /usr/bin/c++ -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -Wl,-z,relro -Wl,-z,now -Wl,--dependency-file=CMakeFiles/spinner-test.dir/link.d "CMakeFiles/spinner-test.dir/spinner-test.cpp.o" "CMakeFiles/test-main.dir/test-main.cpp.o" -o spinner-test -Wl,-rpath,/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu ../libcifpp.so.9.0.5 /usr/lib/libCatch2.a /usr/lib/x86_64-linux-gnu/libz.so make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' [ 89%] Built target spinner-test [ 91%] Linking CXX executable model-test cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/cmake -E cmake_link_script CMakeFiles/model-test.dir/link.txt --verbose=1 [ 93%] Linking CXX executable reconstruction-test cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/cmake -E cmake_link_script CMakeFiles/reconstruction-test.dir/link.txt --verbose=1 /usr/bin/c++ -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -Wl,-z,relro -Wl,-z,now -Wl,--dependency-file=CMakeFiles/model-test.dir/link.d "CMakeFiles/model-test.dir/model-test.cpp.o" "CMakeFiles/test-main.dir/test-main.cpp.o" -o model-test -Wl,-rpath,/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu ../libcifpp.so.9.0.5 /usr/lib/libCatch2.a /usr/lib/x86_64-linux-gnu/libz.so make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' [ 93%] Built target model-test /usr/bin/c++ -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -Wl,-z,relro -Wl,-z,now -Wl,--dependency-file=CMakeFiles/reconstruction-test.dir/link.d "CMakeFiles/reconstruction-test.dir/reconstruction-test.cpp.o" "CMakeFiles/test-main.dir/test-main.cpp.o" -o reconstruction-test -Wl,-rpath,/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu ../libcifpp.so.9.0.5 /usr/lib/libCatch2.a /usr/lib/x86_64-linux-gnu/libz.so make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' [ 93%] Built target reconstruction-test [ 95%] Linking CXX executable matrix-test cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/cmake -E cmake_link_script CMakeFiles/matrix-test.dir/link.txt --verbose=1 /usr/bin/c++ -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -Wl,-z,relro -Wl,-z,now -Wl,--dependency-file=CMakeFiles/matrix-test.dir/link.d "CMakeFiles/matrix-test.dir/matrix-test.cpp.o" "CMakeFiles/test-main.dir/test-main.cpp.o" -o matrix-test -Wl,-rpath,/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu ../libcifpp.so.9.0.5 /usr/lib/libCatch2.a /usr/lib/x86_64-linux-gnu/libz.so make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' [ 95%] Built target matrix-test [ 97%] Linking CXX executable validate-pdbx-test cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/cmake -E cmake_link_script CMakeFiles/validate-pdbx-test.dir/link.txt --verbose=1 /usr/bin/c++ -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -Wl,-z,relro -Wl,-z,now -Wl,--dependency-file=CMakeFiles/validate-pdbx-test.dir/link.d "CMakeFiles/validate-pdbx-test.dir/validate-pdbx-test.cpp.o" "CMakeFiles/test-main.dir/test-main.cpp.o" -o validate-pdbx-test -Wl,-rpath,/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu ../libcifpp.so.9.0.5 /usr/lib/libCatch2.a /usr/lib/x86_64-linux-gnu/libz.so make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' [ 97%] Built target validate-pdbx-test [100%] Linking CXX executable unit-3d-test cd /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test && /usr/bin/cmake -E cmake_link_script CMakeFiles/unit-3d-test.dir/link.txt --verbose=1 /usr/bin/c++ -g -O2 -ffile-prefix-map=/build/reproducible-path/libcifpp-9.0.5=. -fstack-protector-strong -fstack-clash-protection -Wformat -Werror=format-security -fcf-protection -Wdate-time -D_FORTIFY_SOURCE=2 -Wall -Wextra -Wno-unused-parameter -Wno-missing-field-initializers -Wl,-z,relro -Wl,-z,now -Wl,--dependency-file=CMakeFiles/unit-3d-test.dir/link.d "CMakeFiles/unit-3d-test.dir/unit-3d-test.cpp.o" "CMakeFiles/test-main.dir/test-main.cpp.o" -o unit-3d-test -Wl,-rpath,/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu ../libcifpp.so.9.0.5 /usr/lib/libCatch2.a /usr/lib/x86_64-linux-gnu/libz.so make[4]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' [100%] Built target unit-3d-test make[3]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' /usr/bin/cmake -E cmake_progress_start /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/CMakeFiles 0 make[2]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make[1]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5' dh_auto_test -i cd obj-x86_64-linux-gnu && make -j6 test ARGS\+=--verbose ARGS\+=-j6 make[1]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' Running tests... /usr/bin/ctest --force-new-ctest-process --verbose -j6 UpdateCTestConfiguration from :/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/DartConfiguration.tcl Parse Config file:/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/DartConfiguration.tcl UpdateCTestConfiguration from :/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/DartConfiguration.tcl Parse Config file:/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/DartConfiguration.tcl Test project /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu Constructing a list of tests Done constructing a list of tests Updating test list for fixtures Added 0 tests to meet fixture requirements Checking test dependency graph... Checking test dependency graph end Connected to MAKE jobserver test 1 Start 1: unit-v2-test 1: Test command: /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test/unit-v2-test "--data-dir" "/build/reproducible-path/libcifpp-9.0.5/test" 1: Working Directory: /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test 1: Test timeout computed to be: 1500 test 2 Start 2: unit-3d-test 2: Test command: /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test/unit-3d-test "--data-dir" "/build/reproducible-path/libcifpp-9.0.5/test" 2: Working Directory: /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test 2: Test timeout computed to be: 1500 test 3 Start 3: model-test 3: Test command: /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test/model-test "--data-dir" "/build/reproducible-path/libcifpp-9.0.5/test" 3: Working Directory: /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test 3: Test timeout computed to be: 1500 test 4 Start 4: query-test 4: Test command: /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test/query-test "--data-dir" "/build/reproducible-path/libcifpp-9.0.5/test" 4: Working Directory: /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test 4: Test timeout computed to be: 1500 test 5 Start 5: rename-compound-test 5: Test command: /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test/rename-compound-test "--data-dir" "/build/reproducible-path/libcifpp-9.0.5/test" 5: Working Directory: /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test 5: Test timeout computed to be: 1500 test 6 Start 6: sugar-test 6: Test command: /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test/sugar-test "--data-dir" "/build/reproducible-path/libcifpp-9.0.5/test" 6: Working Directory: /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test 6: Test timeout computed to be: 1500 5: Randomness seeded to: 2628898319 5: inconsistent mandatory value for _diffrn_refln.standard_code in dictionary 5: choosing N 1: Randomness seeded to: 187907213 1: =============================================================================== 1: All tests passed (100072 assertions in 7 test cases) 1: 1/9 Test #1: unit-v2-test ..................... Passed 0.07 sec test 7 Start 7: reconstruction-test 7: Test command: /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test/reconstruction-test "--data-dir" "/build/reproducible-path/libcifpp-9.0.5/test" 7: Working Directory: /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test 7: Test timeout computed to be: 1500 5: inconsistent mandatory value for _diffrn_refln.frame_id in dictionary 5: choosing N 3: Randomness seeded to: 110348064 3: Warning: no atoms loaded 3: Warning: no atoms loaded 5: Creating component index ... done 5: Loading component RXA... done 5: Will not rename in child category since there are already rows that link to the parent 5: data_1CBS 5: # 5: _entry.id 1CBS 5: # 5: _audit_conform.dict_name mmcif_pdbx.dic 5: _audit_conform.dict_version 5.279 5: _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 5: # 5: _struct_biol.id 1 5: # 5: loop_ 5: _entity.id 5: _entity.type 5: _entity.src_method 5: _entity.pdbx_description 5: _entity.formula_weight 5: _entity.pdbx_number_of_molecules 5: _entity.pdbx_ec 5: _entity.pdbx_mutation 5: _entity.pdbx_fragment 5: _entity.details 5: 1 polymer man 'CELLULAR RETINOIC ACID BINDING PROTEIN TYPE II' 15581.802 1 ? ? ? ? 5: 3 water nat water 18.015 100 ? ? ? ? 5: 4 non-polymer ? 'RENAMED RETINOIC ACID' 300.435 1 ? ? ? ? 5: # 5: _symmetry.entry_id 1CBS 5: _symmetry.space_group_name_H-M 'P 21 21 21' 5: _symmetry.pdbx_full_space_group_name_H-M ? 5: _symmetry.cell_setting ? 5: _symmetry.Int_Tables_number 19 5: # 5: _struct_site.id AC1 5: _struct_site.pdbx_evidence_code Software 5: _struct_site.pdbx_auth_asym_id ? 5: _struct_site.pdbx_auth_comp_id ? 5: _struct_site.pdbx_auth_seq_id ? 5: _struct_site.pdbx_auth_ins_code ? 5: _struct_site.pdbx_num_residues 10 5: _struct_site.details 'BINDING SITE FOR RESIDUE REA A 200' 5: # 5: _struct_sheet.id A 5: _struct_sheet.type ? 5: _struct_sheet.number_strands 10 5: _struct_sheet.details ? 5: # 5: _struct_ref.id 1 5: _struct_ref.db_name UNP 5: _struct_ref.db_code RABP2_HUMAN 5: _struct_ref.entity_id 1 5: _struct_ref.pdbx_db_accession P29373 5: _struct_ref.pdbx_align_begin 1 5: _struct_ref.pdbx_seq_one_letter_code 5: ;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP 5: CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE 5: ; 5: _struct_ref.pdbx_db_isoform ? 5: # 5: _struct_keywords.entry_id 1CBS 5: _struct_keywords.pdbx_keywords 'RETINOIC-ACID TRANSPORT' 5: _struct_keywords.text 'RETINOIC-ACID TRANSPORT' 5: # 5: _struct_conf_type.id HELX_P 5: _struct_conf_type.criteria ? 5: _struct_conf_type.reference ? 5: # 5: loop_ 5: _struct_asym.id 5: _struct_asym.pdbx_blank_PDB_chainid_flag 5: _struct_asym.pdbx_modified 5: _struct_asym.entity_id 5: _struct_asym.details 5: A N N 1 ? 5: B N N 4 ? 5: C N N 3 ? 5: # 5: _struct.entry_id 1CBS 5: _struct.title 5: ;CRYSTAL STRUCTURE OF CELLULAR RETINOIC-ACID-BINDING PROTEINS I AND II IN COMPLEX WITH ALL-TRANS-RETINOIC ACID AND A SYNTHETIC RETINOID 5: ; 5: _struct.pdbx_descriptor 5: 'CELLULAR RETINOIC-ACID-BINDING PROTEIN TYPE II COMPLEXED WITH ALL-TRANS-RETINOIC ACID (THE PRESUMED PHYSIOLOGICAL LIGAND)' 5: _struct.pdbx_model_details ? 5: _struct.pdbx_CASP_flag ? 5: _struct.pdbx_model_type_details ? 5: # 5: _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' 5: _refine_hist.cycle_id LAST 5: _refine_hist.pdbx_number_atoms_protein 1091 5: _refine_hist.pdbx_number_atoms_nucleic_acid 0 5: _refine_hist.pdbx_number_atoms_ligand 22 5: _refine_hist.number_atoms_solvent 100 5: _refine_hist.number_atoms_total 1213 5: _refine_hist.d_res_high 1.8 5: _refine_hist.d_res_low 8.0 5: # 5: _refine.entry_id 1CBS 5: _refine.ls_number_reflns_obs 14312 5: _refine.ls_number_reflns_all ? 5: _refine.pdbx_ls_sigma_I ? 5: _refine.pdbx_ls_sigma_F 2. 5: _refine.pdbx_data_cutoff_high_absF ? 5: _refine.pdbx_data_cutoff_low_absF ? 5: _refine.pdbx_data_cutoff_high_rms_absF ? 5: _refine.ls_d_res_low 8.0 5: _refine.ls_d_res_high 1.8 5: _refine.ls_percent_reflns_obs 90.3 5: _refine.ls_R_factor_obs 0.2000000 5: _refine.ls_R_factor_all ? 5: _refine.ls_R_factor_R_work 0.2000000 5: _refine.ls_R_factor_R_free 0.2370000 5: _refine.ls_R_factor_R_free_error ? 5: _refine.ls_R_factor_R_free_error_details ? 5: _refine.ls_percent_reflns_R_free ? 5: _refine.ls_number_reflns_R_free ? 5: _refine.ls_number_parameters ? 5: _refine.ls_number_restraints ? 5: _refine.occupancy_min ? 5: _refine.occupancy_max ? 5: _refine.B_iso_mean 16.6 5: _refine.aniso_B[1][1] ? 5: _refine.aniso_B[2][2] ? 5: _refine.aniso_B[3][3] ? 5: _refine.aniso_B[1][2] ? 5: _refine.aniso_B[1][3] ? 5: _refine.aniso_B[2][3] ? 5: _refine.solvent_model_details ? 5: _refine.solvent_model_param_ksol ? 5: _refine.solvent_model_param_bsol ? 5: _refine.pdbx_ls_cross_valid_method ? 5: _refine.details ? 5: _refine.pdbx_starting_model ? 5: _refine.pdbx_method_to_determine_struct ? 5: _refine.pdbx_isotropic_thermal_model ? 5: _refine.pdbx_stereochemistry_target_values ? 5: _refine.pdbx_stereochem_target_val_spec_case ? 5: _refine.pdbx_R_Free_selection_details ? 5: _refine.pdbx_overall_ESU_R ? 5: _refine.pdbx_overall_ESU_R_Free ? 5: _refine.overall_SU_ML ? 5: _refine.overall_SU_B ? 5: _refine.pdbx_refine_id 'X-RAY DIFFRACTION' 5: _refine.pdbx_diffrn_id 1 5: _refine.pdbx_TLS_residual_ADP_flag ? 5: _refine.correlation_coeff_Fo_to_Fc ? 5: _refine.correlation_coeff_Fo_to_Fc_free ? 5: _refine.pdbx_solvent_vdw_probe_radii ? 5: _refine.pdbx_solvent_ion_probe_radii ? 5: _refine.pdbx_solvent_shrinkage_radii ? 5: _refine.pdbx_overall_phase_error ? 5: _refine.overall_SU_R_Cruickshank_DPI ? 5: _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? 5: _refine.pdbx_overall_SU_R_Blow_DPI ? 5: _refine.pdbx_overall_SU_R_free_Blow_DPI ? 5: # 5: _pdbx_struct_oper_list.id 1 5: _pdbx_struct_oper_list.type 'identity operation' 5: _pdbx_struct_oper_list.name 1_555 5: _pdbx_struct_oper_list.symmetry_operation x,y,z 5: _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 5: _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 5: _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 5: _pdbx_struct_oper_list.vector[1] 0.0000000000 5: _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 5: _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 5: _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 5: _pdbx_struct_oper_list.vector[2] 0.0000000000 5: _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 5: _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 5: _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 5: _pdbx_struct_oper_list.vector[3] 0.0000000000 5: # 5: _pdbx_struct_assembly.id 1 5: _pdbx_struct_assembly.details author_defined_assembly 5: _pdbx_struct_assembly.method_details ? 5: _pdbx_struct_assembly.oligomeric_details monomeric 5: _pdbx_struct_assembly.oligomeric_count 1 5: # 5: _pdbx_database_status.status_code REL 5: _pdbx_database_status.entry_id 1CBS 5: _pdbx_database_status.recvd_initial_deposition_date 1994-09-28 5: _pdbx_database_status.deposit_site ? 5: _pdbx_database_status.process_site ? 5: _pdbx_database_status.status_code_sf REL 5: _pdbx_database_status.status_code_mr ? 5: _pdbx_database_status.SG_entry ? 5: _pdbx_database_status.pdb_format_compatible Y 5: _pdbx_database_status.status_code_cs ? 5: # 5: loop_ 5: _pdbx_audit_revision_history.ordinal 5: _pdbx_audit_revision_history.data_content_type 5: _pdbx_audit_revision_history.major_revision 5: _pdbx_audit_revision_history.minor_revision 5: _pdbx_audit_revision_history.revision_date 5: 1 'Structure model' 1 0 1995-01-26 5: 2 'Structure model' 1 1 2008-03-24 5: 3 'Structure model' 1 2 2011-07-13 5: # 5: _exptl_crystal.id 1 5: _exptl_crystal.density_meas ? 5: _exptl_crystal.density_Matthews 2.70 5: _exptl_crystal.density_percent_sol 54.49 5: _exptl_crystal.description ? 5: # 5: _exptl.entry_id 1CBS 5: _exptl.method 'X-RAY DIFFRACTION' 5: _exptl.crystals_number ? 5: # 5: _entity_src_gen.entity_id 1 5: _entity_src_gen.pdbx_src_id 1 5: _entity_src_gen.pdbx_alt_source_flag sample 5: _entity_src_gen.pdbx_seq_type ? 5: _entity_src_gen.pdbx_beg_seq_num ? 5: _entity_src_gen.pdbx_end_seq_num ? 5: _entity_src_gen.gene_src_common_name human 5: _entity_src_gen.gene_src_genus Homo 5: _entity_src_gen.pdbx_gene_src_gene 'HUMAN CRABP-II' 5: _entity_src_gen.gene_src_species ? 5: _entity_src_gen.gene_src_strain ? 5: _entity_src_gen.gene_src_tissue ? 5: _entity_src_gen.gene_src_tissue_fraction ? 5: _entity_src_gen.gene_src_details ? 5: _entity_src_gen.pdbx_gene_src_fragment ? 5: _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' 5: _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 5: _entity_src_gen.pdbx_gene_src_variant ? 5: _entity_src_gen.pdbx_gene_src_cell_line BL21 5: _entity_src_gen.pdbx_gene_src_atcc ? 5: _entity_src_gen.pdbx_gene_src_organ ? 5: _entity_src_gen.pdbx_gene_src_organelle ? 5: _entity_src_gen.pdbx_gene_src_cell ? 5: _entity_src_gen.pdbx_gene_src_cellular_location ? 5: _entity_src_gen.host_org_common_name ? 5: _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' 5: _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 5: _entity_src_gen.host_org_genus Escherichia 5: _entity_src_gen.pdbx_host_org_gene ? 5: _entity_src_gen.pdbx_host_org_organ ? 5: _entity_src_gen.host_org_species 'Escherichia coli' 5: _entity_src_gen.pdbx_host_org_tissue ? 5: _entity_src_gen.pdbx_host_org_tissue_fraction ? 5: _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' 5: _entity_src_gen.pdbx_host_org_variant ? 5: _entity_src_gen.pdbx_host_org_cell_line ? 5: _entity_src_gen.pdbx_host_org_atcc ? 5: _entity_src_gen.pdbx_host_org_culture_collection ? 5: _entity_src_gen.pdbx_host_org_cell ? 5: _entity_src_gen.pdbx_host_org_organelle ? 5: _entity_src_gen.pdbx_host_org_cellular_location ? 5: _entity_src_gen.pdbx_host_org_vector_type ? 5: _entity_src_gen.pdbx_host_org_vector ? 5: _entity_src_gen.host_org_details ? 5: _entity_src_gen.expression_system_id ? 5: _entity_src_gen.plasmid_name PET-3A 5: _entity_src_gen.plasmid_details ? 5: _entity_src_gen.pdbx_description ? 5: # 5: _entity_poly.entity_id 1 5: _entity_poly.type polypeptide(L) 5: _entity_poly.nstd_linkage no 5: _entity_poly.nstd_monomer no 5: _entity_poly.pdbx_seq_one_letter_code 5: ;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP 5: CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE 5: ; 5: _entity_poly.pdbx_seq_one_letter_code_can 5: ;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP 5: CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE 5: ; 5: _entity_poly.pdbx_strand_id A 5: _entity_poly.pdbx_target_identifier ? 5: # 5: _diffrn_radiation_wavelength.id 1 5: _diffrn_radiation_wavelength.wavelength . 5: _diffrn_radiation_wavelength.wt 1.0 5: # 5: _database_PDB_matrix.entry_id 1CBS 5: _database_PDB_matrix.origx[1][1] 1.000000 5: _database_PDB_matrix.origx[1][2] 0.000000 5: _database_PDB_matrix.origx[1][3] 0.000000 5: _database_PDB_matrix.origx[2][1] 0.000000 5: _database_PDB_matrix.origx[2][2] 1.000000 5: _database_PDB_matrix.origx[2][3] 0.000000 5: _database_PDB_matrix.origx[3][1] 0.000000 5: _database_PDB_matrix.origx[3][2] 0.000000 5: _database_PDB_matrix.origx[3][3] 1.000000 5: _database_PDB_matrix.origx_vector[1] 0.00000 5: _database_PDB_matrix.origx_vector[2] 0.00000 5: _database_PDB_matrix.origx_vector[3] 0.00000 5: # 5: loop_ 5: _database_2.database_id 5: _database_2.database_code 5: PDB 1CBS 5: WWPDB D_1000172215 5: # 5: loop_ 5: _citation.id 5: _citation.title 5: _citation.journal_abbrev 5: _citation.journal_volume 5: _citation.page_first 5: _citation.page_last 5: _citation.year 5: _citation.journal_id_ASTM 5: _citation.country 5: _citation.journal_id_ISSN 5: _citation.journal_id_CSD 5: _citation.book_publisher 5: _citation.pdbx_database_id_PubMed 5: _citation.pdbx_database_id_DOI 5: primary 5: ;Crystal structures of cellular retinoic acid binding proteins I and II in complex with all-trans-retinoic acid and a synthetic retinoid. 5: ; 5: Structure 2 1241 1258 1994 STRUE6 UK 0969-2126 2005 ? 7704533 10.1016/S0969-2126(94)00125-1 5: 1 'Lipid-Binding Proteins: A Family of Fatty Acid and Retinoid Transport Proteins' 5: 'Adv.Protein Chem.' 45 89 ? 1994 APCHA2 US 0065-3233 0433 ? ? ? 5: 2 'Crystallisation and Preliminary X-Ray Analysis of Recombinant Bovine Cellular Retinoic Acid-Binding Protein' 5: 'Acta Crystallogr.,Sect.D' 50 370 ? 1994 ABCRE6 DK 0907-4449 0766 ? ? ? 5: 3 5: ;Crystallographic Studies on a Family of Lipophilic Transport Proteins. Refinement of P2 Myelin Protein and the Structure Determination and Refinement of Cellular Retinol-Binding Protein in Complex with All-Trans-Retinol 5: ; 5: J.Mol.Biol. 230 1225 ? 1993 JMOBAK UK 0022-2836 0070 ? ? ? 5: 4 'The Three-Dimensional Structure of P2 Myelin Protein' 5: 'Embo J.' 7 1597 ? 1988 EMJODG UK 0261-4189 0897 ? ? ? 5: # 5: loop_ 5: _chem_comp.id 5: _chem_comp.type 5: _chem_comp.mon_nstd_flag 5: _chem_comp.name 5: _chem_comp.pdbx_synonyms 5: _chem_comp.formula 5: _chem_comp.formula_weight 5: ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 5: ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 5: ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 5: ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 5: CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 5: GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 5: GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 5: GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 5: HOH non-polymer . WATER ? 'H2 O' 18.015 5: ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 5: LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 5: LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 5: MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 5: PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 5: PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 5: SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 5: THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 5: TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 5: TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 5: VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 5: RXA NON-POLYMER ? 'RENAMED RETINOIC ACID' ? 'C20 H28 O2' 300.435 5: # 5: _cell.entry_id 1CBS 5: _cell.length_a 45.650 5: _cell.length_b 47.560 5: _cell.length_c 77.610 5: _cell.angle_alpha 90.00 5: _cell.angle_beta 90.00 5: _cell.angle_gamma 90.00 5: _cell.Z_PDB 4 5: _cell.pdbx_unique_axis ? 5: # 5: loop_ 5: _audit_author.name 5: _audit_author.pdbx_ordinal 5: 'Kleywegt, G.J.' 1 5: 'Bergfors, T.' 2 5: 'Jones, T.A.' 3 5: # 5: loop_ 5: _atom_type.symbol 5: C 5: N 5: O 5: S 5: # 5: _atom_sites.entry_id 1CBS 5: _atom_sites.fract_transf_matrix[1][1] 0.021906 5: _atom_sites.fract_transf_matrix[1][2] 0.000000 5: _atom_sites.fract_transf_matrix[1][3] 0.000000 5: _atom_sites.fract_transf_matrix[2][1] 0.000000 5: _atom_sites.fract_transf_matrix[2][2] 0.021026 5: _atom_sites.fract_transf_matrix[2][3] 0.000000 5: _atom_sites.fract_transf_matrix[3][1] 0.000000 5: _atom_sites.fract_transf_matrix[3][2] 0.000000 5: _atom_sites.fract_transf_matrix[3][3] 0.012885 5: _atom_sites.fract_transf_vector[1] 0.00000 5: _atom_sites.fract_transf_vector[2] 0.00000 5: _atom_sites.fract_transf_vector[3] 0.00000 5: # 5: loop_ 5: _software.name 5: _software.classification 5: _software.version 5: _software.citation_id 5: _software.pdbx_ordinal 5: X-PLOR 'model building' . ? 1 5: X-PLOR refinement . ? 2 5: X-PLOR phasing . ? 3 5: # 5: loop_ 5: _refine_ls_restr.type 5: _refine_ls_restr.dev_ideal 5: _refine_ls_restr.dev_ideal_target 5: _refine_ls_restr.weight 5: _refine_ls_restr.number 5: _refine_ls_restr.pdbx_refine_id 5: _refine_ls_restr.pdbx_restraint_function 5: x_bond_d 0.010 ? ? ? 'X-RAY DIFFRACTION' ? 5: x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_angle_deg 1.51 ? ? ? 'X-RAY DIFFRACTION' ? 5: x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_dihedral_angle_d 27.4 ? ? ? 'X-RAY DIFFRACTION' ? 5: x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_improper_angle_d 1.32 ? ? ? 'X-RAY DIFFRACTION' ? 5: x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? 5: # 5: _refine_analyze.entry_id 1CBS 5: _refine_analyze.Luzzati_coordinate_error_obs 0.2 5: _refine_analyze.Luzzati_sigma_a_obs ? 5: _refine_analyze.Luzzati_d_res_low_obs ? 5: _refine_analyze.Luzzati_coordinate_error_free ? 5: _refine_analyze.Luzzati_sigma_a_free ? 5: _refine_analyze.Luzzati_d_res_low_free ? 5: _refine_analyze.number_disordered_residues ? 5: _refine_analyze.occupancy_sum_hydrogen ? 5: _refine_analyze.occupancy_sum_non_hydrogen ? 5: _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' 5: # 5: _pdbx_struct_assembly_gen.assembly_id 1 5: _pdbx_struct_assembly_gen.oper_expression 1 5: _pdbx_struct_assembly_gen.asym_id_list A,B,C 5: # 5: loop_ 5: _pdbx_audit_revision_group.ordinal 5: _pdbx_audit_revision_group.revision_ordinal 5: _pdbx_audit_revision_group.data_content_type 5: _pdbx_audit_revision_group.group 5: 1 2 'Structure model' 'Version format compliance' 5: 2 3 'Structure model' 'Version format compliance' 5: # 5: _pdbx_audit_revision_details.ordinal 1 5: _pdbx_audit_revision_details.revision_ordinal 1 5: _pdbx_audit_revision_details.data_content_type 'Structure model' 5: _pdbx_audit_revision_details.provider repository 5: _pdbx_audit_revision_details.type 'Initial release' 5: _pdbx_audit_revision_details.description ? 5: # 5: _diffrn.id 1 5: _diffrn.ambient_temp ? 5: _diffrn.ambient_temp_details ? 5: _diffrn.crystal_id 1 5: # 5: loop_ 5: _citation_author.citation_id 5: _citation_author.name 5: _citation_author.ordinal 5: primary 'Kleywegt, G.J.' 1 5: primary 'Bergfors, T.' 2 5: primary 'Senn, H.' 3 5: primary 'Le Motte, P.' 4 5: primary 'Gsell, B.' 5 5: primary 'Shudo, K.' 6 5: primary 'Jones, T.A.' 7 5: 1 'Banaszak, L.' 8 5: 1 'Winter, N.' 9 5: 1 'Xu, Z.' 10 5: 1 'Bernlohr, D.A.' 11 5: 1 'Cowan, S.W.' 12 5: 1 'Jones, T.A.' 13 5: 2 'Bergfors, T.' 14 5: 2 'Kleywegt, G.J.' 15 5: 2 'Jones, T.A.' 16 5: 3 'Cowan, S.W.' 17 5: 3 'Newcomer, M.E.' 18 5: 3 'Jones, T.A.' 19 5: 4 'Jones, T.A.' 20 5: 4 'Bergfors, T.' 21 5: 4 'Sedzik, J.' 22 5: 4 'Unge, T.' 23 5: # 5: _reflns.entry_id 1CBS 5: _reflns.observed_criterion_sigma_I 3. 5: _reflns.observed_criterion_sigma_F ? 5: _reflns.d_resolution_low ? 5: _reflns.d_resolution_high ? 5: _reflns.number_obs 14678 5: _reflns.number_all ? 5: _reflns.percent_possible_obs 90.3 5: _reflns.pdbx_Rmerge_I_obs ? 5: _reflns.pdbx_Rsym_value ? 5: _reflns.pdbx_netI_over_sigmaI ? 5: _reflns.B_iso_Wilson_estimate ? 5: _reflns.pdbx_redundancy ? 5: _reflns.pdbx_diffrn_id 1 5: _reflns.pdbx_ordinal 1 5: # 5: loop_ 5: _entity_poly_seq.entity_id 5: _entity_poly_seq.num 5: _entity_poly_seq.mon_id 5: _entity_poly_seq.hetero 5: 1 1 PRO n 5: 1 2 ASN n 5: 1 3 PHE n 5: 1 4 SER n 5: 1 5 GLY n 5: 1 6 ASN n 5: 1 7 TRP n 5: 1 8 LYS n 5: 1 9 ILE n 5: 1 10 ILE n 5: 1 11 ARG n 5: 1 12 SER n 5: 1 13 GLU n 5: 1 14 ASN n 5: 1 15 PHE n 5: 1 16 GLU n 5: 1 17 GLU n 5: 1 18 LEU n 5: 1 19 LEU n 5: 1 20 LYS n 5: 1 21 VAL n 5: 1 22 LEU n 5: 1 23 GLY n 5: 1 24 VAL n 5: 1 25 ASN n 5: 1 26 VAL n 5: 1 27 MET n 5: 1 28 LEU n 5: 1 29 ARG n 5: 1 30 LYS n 5: 1 31 ILE n 5: 1 32 ALA n 5: 1 33 VAL n 5: 1 34 ALA n 5: 1 35 ALA n 5: 1 36 ALA n 5: 1 37 SER n 5: 1 38 LYS n 5: 1 39 PRO n 5: 1 40 ALA n 5: 1 41 VAL n 5: 1 42 GLU n 5: 1 43 ILE n 5: 1 44 LYS n 5: 1 45 GLN n 5: 1 46 GLU n 5: 1 47 GLY n 5: 1 48 ASP n 5: 1 49 THR n 5: 1 50 PHE n 5: 1 51 TYR n 5: 1 52 ILE n 5: 1 53 LYS n 5: 1 54 THR n 5: 1 55 SER n 5: 1 56 THR n 5: 1 57 THR n 5: 1 58 VAL n 5: 1 59 ARG n 5: 1 60 THR n 5: 1 61 THR n 5: 1 62 GLU n 5: 1 63 ILE n 5: 1 64 ASN n 5: 1 65 PHE n 5: 1 66 LYS n 5: 1 67 VAL n 5: 1 68 GLY n 5: 1 69 GLU n 5: 1 70 GLU n 5: 1 71 PHE n 5: 1 72 GLU n 5: 1 73 GLU n 5: 1 74 GLN n 5: 1 75 THR n 5: 1 76 VAL n 5: 1 77 ASP n 5: 1 78 GLY n 5: 1 79 ARG n 5: 1 80 PRO n 5: 1 81 CYS n 5: 1 82 LYS n 5: 1 83 SER n 5: 1 84 LEU n 5: 1 85 VAL n 5: 1 86 LYS n 5: 1 87 TRP n 5: 1 88 GLU n 5: 1 89 SER n 5: 1 90 GLU n 5: 1 91 ASN n 5: 1 92 LYS n 5: 1 93 MET n 5: 1 94 VAL n 5: 1 95 CYS n 5: 1 96 GLU n 5: 1 97 GLN n 5: 1 98 LYS n 5: 1 99 LEU n 5: 1 100 LEU n 5: 1 101 LYS n 5: 1 102 GLY n 5: 1 103 GLU n 5: 1 104 GLY n 5: 1 105 PRO n 5: 1 106 LYS n 5: 1 107 THR n 5: 1 108 SER n 5: 1 109 TRP n 5: 1 110 THR n 5: 1 111 ARG n 5: 1 112 GLU n 5: 1 113 LEU n 5: 1 114 THR n 5: 1 115 ASN n 5: 1 116 ASP n 5: 1 117 GLY n 5: 1 118 GLU n 5: 1 119 LEU n 5: 1 120 ILE n 5: 1 121 LEU n 5: 1 122 THR n 5: 1 123 MET n 5: 1 124 THR n 5: 1 125 ALA n 5: 1 126 ASP n 5: 1 127 ASP n 5: 1 128 VAL n 5: 1 129 VAL n 5: 1 130 CYS n 5: 1 131 THR n 5: 1 132 ARG n 5: 1 133 VAL n 5: 1 134 TYR n 5: 1 135 VAL n 5: 1 136 ARG n 5: 1 137 GLU n 5: # 5: _diffrn_radiation.diffrn_id 1 5: _diffrn_radiation.wavelength_id 1 5: _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? 5: _diffrn_radiation.monochromator ? 5: _diffrn_radiation.pdbx_diffrn_protocol ? 5: _diffrn_radiation.pdbx_scattering_type x-ray 5: # 5: loop_ 5: _pdbx_poly_seq_scheme.asym_id 5: _pdbx_poly_seq_scheme.entity_id 5: _pdbx_poly_seq_scheme.seq_id 5: _pdbx_poly_seq_scheme.mon_id 5: _pdbx_poly_seq_scheme.ndb_seq_num 5: _pdbx_poly_seq_scheme.pdb_seq_num 5: _pdbx_poly_seq_scheme.auth_seq_num 5: _pdbx_poly_seq_scheme.pdb_mon_id 5: _pdbx_poly_seq_scheme.auth_mon_id 5: _pdbx_poly_seq_scheme.pdb_strand_id 5: _pdbx_poly_seq_scheme.pdb_ins_code 5: _pdbx_poly_seq_scheme.hetero 5: A 1 1 PRO 1 1 1 PRO PRO A . n 5: A 1 2 ASN 2 2 2 ASN ASN A . n 5: A 1 3 PHE 3 3 3 PHE PHE A . n 5: A 1 4 SER 4 4 4 SER SER A . n 5: A 1 5 GLY 5 5 5 GLY GLY A . n 5: A 1 6 ASN 6 6 6 ASN ASN A . n 5: A 1 7 TRP 7 7 7 TRP TRP A . n 5: A 1 8 LYS 8 8 8 LYS LYS A . n 5: A 1 9 ILE 9 9 9 ILE ILE A . n 5: A 1 10 ILE 10 10 10 ILE ILE A . n 5: A 1 11 ARG 11 11 11 ARG ARG A . n 5: A 1 12 SER 12 12 12 SER SER A . n 5: A 1 13 GLU 13 13 13 GLU GLU A . n 5: A 1 14 ASN 14 14 14 ASN ASN A . n 5: A 1 15 PHE 15 15 15 PHE PHE A . n 5: A 1 16 GLU 16 16 16 GLU GLU A . n 5: A 1 17 GLU 17 17 17 GLU GLU A . n 5: A 1 18 LEU 18 18 18 LEU LEU A . n 5: A 1 19 LEU 19 19 19 LEU LEU A . n 5: A 1 20 LYS 20 20 20 LYS LYS A . n 5: A 1 21 VAL 21 21 21 VAL VAL A . n 5: A 1 22 LEU 22 22 22 LEU LEU A . n 5: A 1 23 GLY 23 23 23 GLY GLY A . n 5: A 1 24 VAL 24 24 24 VAL VAL A . n 5: A 1 25 ASN 25 25 25 ASN ASN A . n 5: A 1 26 VAL 26 26 26 VAL VAL A . n 5: A 1 27 MET 27 27 27 MET MET A . n 5: A 1 28 LEU 28 28 28 LEU LEU A . n 5: A 1 29 ARG 29 29 29 ARG ARG A . n 5: A 1 30 LYS 30 30 30 LYS LYS A . n 5: A 1 31 ILE 31 31 31 ILE ILE A . n 5: A 1 32 ALA 32 32 32 ALA ALA A . n 5: A 1 33 VAL 33 33 33 VAL VAL A . n 5: A 1 34 ALA 34 34 34 ALA ALA A . n 5: A 1 35 ALA 35 35 35 ALA ALA A . n 5: A 1 36 ALA 36 36 36 ALA ALA A . n 5: A 1 37 SER 37 37 37 SER SER A . n 5: A 1 38 LYS 38 38 38 LYS LYS A . n 5: A 1 39 PRO 39 39 39 PRO PRO A . n 5: A 1 40 ALA 40 40 40 ALA ALA A . n 5: A 1 41 VAL 41 41 41 VAL VAL A . n 5: A 1 42 GLU 42 42 42 GLU GLU A . n 5: A 1 43 ILE 43 43 43 ILE ILE A . n 5: A 1 44 LYS 44 44 44 LYS LYS A . n 5: A 1 45 GLN 45 45 45 GLN GLN A . n 5: A 1 46 GLU 46 46 46 GLU GLU A . n 5: A 1 47 GLY 47 47 47 GLY GLY A . n 5: A 1 48 ASP 48 48 48 ASP ASP A . n 5: A 1 49 THR 49 49 49 THR THR A . n 5: A 1 50 PHE 50 50 50 PHE PHE A . n 5: A 1 51 TYR 51 51 51 TYR TYR A . n 5: A 1 52 ILE 52 52 52 ILE ILE A . n 5: A 1 53 LYS 53 53 53 LYS LYS A . n 5: A 1 54 THR 54 54 54 THR THR A . n 5: A 1 55 SER 55 55 55 SER SER A . n 5: A 1 56 THR 56 56 56 THR THR A . n 5: A 1 57 THR 57 57 57 THR THR A . n 5: A 1 58 VAL 58 58 58 VAL VAL A . n 5: A 1 59 ARG 59 59 59 ARG ARG A . n 5: A 1 60 THR 60 60 60 THR THR A . n 5: A 1 61 THR 61 61 61 THR THR A . n 5: A 1 62 GLU 62 62 62 GLU GLU A . n 5: A 1 63 ILE 63 63 63 ILE ILE A . n 5: A 1 64 ASN 64 64 64 ASN ASN A . n 5: A 1 65 PHE 65 65 65 PHE PHE A . n 5: A 1 66 LYS 66 66 66 LYS LYS A . n 5: A 1 67 VAL 67 67 67 VAL VAL A . n 5: A 1 68 GLY 68 68 68 GLY GLY A . n 5: A 1 69 GLU 69 69 69 GLU GLU A . n 5: A 1 70 GLU 70 70 70 GLU GLU A . n 5: A 1 71 PHE 71 71 71 PHE PHE A . n 5: A 1 72 GLU 72 72 72 GLU GLU A . n 5: A 1 73 GLU 73 73 73 GLU GLU A . n 5: A 1 74 GLN 74 74 74 GLN GLN A . n 5: A 1 75 THR 75 75 75 THR THR A . n 5: A 1 76 VAL 76 76 76 VAL VAL A . n 5: A 1 77 ASP 77 77 77 ASP ASP A . n 5: A 1 78 GLY 78 78 78 GLY GLY A . n 5: A 1 79 ARG 79 79 79 ARG ARG A . n 5: A 1 80 PRO 80 80 80 PRO PRO A . n 5: A 1 81 CYS 81 81 81 CYS CYS A . n 5: A 1 82 LYS 82 82 82 LYS LYS A . n 5: A 1 83 SER 83 83 83 SER SER A . n 5: A 1 84 LEU 84 84 84 LEU LEU A . n 5: A 1 85 VAL 85 85 85 VAL VAL A . n 5: A 1 86 LYS 86 86 86 LYS LYS A . n 5: A 1 87 TRP 87 87 87 TRP TRP A . n 5: A 1 88 GLU 88 88 88 GLU GLU A . n 5: A 1 89 SER 89 89 89 SER SER A . n 5: A 1 90 GLU 90 90 90 GLU GLU A . n 5: A 1 91 ASN 91 91 91 ASN ASN A . n 5: A 1 92 LYS 92 92 92 LYS LYS A . n 5: A 1 93 MET 93 93 93 MET MET A . n 5: A 1 94 VAL 94 94 94 VAL VAL A . n 5: A 1 95 CYS 95 95 95 CYS CYS A . n 5: A 1 96 GLU 96 96 96 GLU GLU A . n 5: A 1 97 GLN 97 97 97 GLN GLN A . n 5: A 1 98 LYS 98 98 98 LYS LYS A . n 5: A 1 99 LEU 99 99 99 LEU LEU A . n 5: A 1 100 LEU 100 100 100 LEU LEU A . n 5: A 1 101 LYS 101 101 101 LYS LYS A . n 5: A 1 102 GLY 102 102 102 GLY GLY A . n 5: A 1 103 GLU 103 103 103 GLU GLU A . n 5: A 1 104 GLY 104 104 104 GLY GLY A . n 5: A 1 105 PRO 105 105 105 PRO PRO A . n 5: A 1 106 LYS 106 106 106 LYS LYS A . n 5: A 1 107 THR 107 107 107 THR THR A . n 5: A 1 108 SER 108 108 108 SER SER A . n 5: A 1 109 TRP 109 109 109 TRP TRP A . n 5: A 1 110 THR 110 110 110 THR THR A . n 5: A 1 111 ARG 111 111 111 ARG ARG A . n 5: A 1 112 GLU 112 112 112 GLU GLU A . n 5: A 1 113 LEU 113 113 113 LEU LEU A . n 5: A 1 114 THR 114 114 114 THR THR A . n 5: A 1 115 ASN 115 115 115 ASN ASN A . n 5: A 1 116 ASP 116 116 116 ASP ASP A . n 5: A 1 117 GLY 117 117 117 GLY GLY A . n 5: A 1 118 GLU 118 118 118 GLU GLU A . n 5: A 1 119 LEU 119 119 119 LEU LEU A . n 5: A 1 120 ILE 120 120 120 ILE ILE A . n 5: A 1 121 LEU 121 121 121 LEU LEU A . n 5: A 1 122 THR 122 122 122 THR THR A . n 5: A 1 123 MET 123 123 123 MET MET A . n 5: A 1 124 THR 124 124 124 THR THR A . n 5: A 1 125 ALA 125 125 125 ALA ALA A . n 5: A 1 126 ASP 126 126 126 ASP ASP A . n 5: A 1 127 ASP 127 127 127 ASP ASP A . n 5: A 1 128 VAL 128 128 128 VAL VAL A . n 5: A 1 129 VAL 129 129 129 VAL VAL A . n 5: A 1 130 CYS 130 130 130 CYS CYS A . n 5: A 1 131 THR 131 131 131 THR THR A . n 5: A 1 132 ARG 132 132 132 ARG ARG A . n 5: A 1 133 VAL 133 133 133 VAL VAL A . n 5: A 1 134 TYR 134 134 134 TYR TYR A . n 5: A 1 135 VAL 135 135 135 VAL VAL A . n 5: A 1 136 ARG 136 136 136 ARG ARG A . n 5: A 1 137 GLU 137 137 137 GLU GLU A . n 5: # 5: loop_ 5: _atom_site.group_PDB 5: _atom_site.id 5: _atom_site.type_symbol 5: _atom_site.label_atom_id 5: _atom_site.label_alt_id 5: _atom_site.label_comp_id 5: _atom_site.label_asym_id 5: _atom_site.label_entity_id 5: _atom_site.label_seq_id 5: _atom_site.pdbx_PDB_ins_code 5: _atom_site.Cartn_x 5: _atom_site.Cartn_y 5: _atom_site.Cartn_z 5: _atom_site.occupancy 5: _atom_site.B_iso_or_equiv 5: _atom_site.pdbx_formal_charge 5: _atom_site.auth_seq_id 5: _atom_site.auth_comp_id 5: _atom_site.auth_asym_id 5: _atom_site.auth_atom_id 5: _atom_site.pdbx_PDB_model_num 5: ATOM 1 N N . PRO A 1 1 ? 16.979 13.301 44.555 1.00 30.05 ? 1 PRO A N 1 5: ATOM 2 C CA . PRO A 1 1 ? 18.150 13.525 43.680 1.00 28.82 ? 1 PRO A CA 1 5: ATOM 3 C C . PRO A 1 1 ? 18.656 14.966 43.784 1.00 26.59 ? 1 PRO A C 1 5: ATOM 4 O O . PRO A 1 1 ? 17.890 15.889 44.078 1.00 26.84 ? 1 PRO A O 1 5: ATOM 5 C CB . PRO A 1 1 ? 17.678 13.270 42.255 1.00 29.24 ? 1 PRO A CB 1 5: ATOM 6 C CG . PRO A 1 1 ? 16.248 13.734 42.347 1.00 29.29 ? 1 PRO A CG 1 5: ATOM 7 C CD . PRO A 1 1 ? 15.762 13.216 43.724 1.00 30.71 ? 1 PRO A CD 1 5: ATOM 8 N N . ASN A 1 2 ? 19.957 15.139 43.558 1.00 24.04 ? 2 ASN A N 1 5: ATOM 9 C CA . ASN A 1 2 ? 20.576 16.457 43.578 1.00 20.79 ? 2 ASN A CA 1 5: ATOM 10 C C . ASN A 1 2 ? 21.301 16.714 42.262 1.00 16.75 ? 2 ASN A C 1 5: ATOM 11 O O . ASN A 1 2 ? 22.402 16.215 42.028 1.00 15.23 ? 2 ASN A O 1 5: ATOM 12 C CB . ASN A 1 2 ? 21.559 16.620 44.724 1.00 22.81 ? 2 ASN A CB 1 5: ATOM 13 C CG . ASN A 1 2 ? 22.240 17.968 44.685 1.00 24.29 ? 2 ASN A CG 1 5: ATOM 14 O OD1 . ASN A 1 2 ? 21.612 18.984 44.358 1.00 21.87 ? 2 ASN A OD1 1 5: ATOM 15 N ND2 . ASN A 1 2 ? 23.537 17.983 44.966 1.00 27.94 ? 2 ASN A ND2 1 5: ATOM 16 N N . PHE A 1 3 ? 20.637 17.477 41.402 1.00 14.69 ? 3 PHE A N 1 5: ATOM 17 C CA . PHE A 1 3 ? 21.144 17.838 40.087 1.00 12.62 ? 3 PHE A CA 1 5: ATOM 18 C C . PHE A 1 3 ? 22.152 18.987 40.140 1.00 12.43 ? 3 PHE A C 1 5: ATOM 19 O O . PHE A 1 3 ? 22.796 19.289 39.136 1.00 12.12 ? 3 PHE A O 1 5: ATOM 20 C CB . PHE A 1 3 ? 19.970 18.262 39.188 1.00 10.74 ? 3 PHE A CB 1 5: ATOM 21 C CG . PHE A 1 3 ? 19.073 17.128 38.750 1.00 11.85 ? 3 PHE A CG 1 5: ATOM 22 C CD1 . PHE A 1 3 ? 18.066 16.646 39.581 1.00 10.90 ? 3 PHE A CD1 1 5: ATOM 23 C CD2 . PHE A 1 3 ? 19.189 16.588 37.475 1.00 13.26 ? 3 PHE A CD2 1 5: ATOM 24 C CE1 . PHE A 1 3 ? 17.200 15.662 39.149 1.00 9.12 ? 3 PHE A CE1 1 5: ATOM 25 C CE2 . PHE A 1 3 ? 18.312 15.594 37.041 1.00 11.76 ? 3 PHE A CE2 1 5: ATOM 26 C CZ . PHE A 1 3 ? 17.324 15.137 37.878 1.00 10.30 ? 3 PHE A CZ 1 5: ATOM 27 N N . SER A 1 4 ? 22.282 19.630 41.299 1.00 11.24 ? 4 SER A N 1 5: ATOM 28 C CA . SER A 1 4 ? 23.170 20.780 41.464 1.00 11.30 ? 4 SER A CA 1 5: ATOM 29 C C . SER A 1 4 ? 24.627 20.568 41.091 1.00 10.39 ? 4 SER A C 1 5: ATOM 30 O O . SER A 1 4 ? 25.201 19.532 41.384 1.00 10.24 ? 4 SER A O 1 5: ATOM 31 C CB . SER A 1 4 ? 23.112 21.301 42.906 1.00 13.53 ? 4 SER A CB 1 5: ATOM 32 O OG . SER A 1 4 ? 21.821 21.787 43.240 1.00 16.76 ? 4 SER A OG 1 5: ATOM 33 N N . GLY A 1 5 ? 25.224 21.572 40.460 1.00 9.87 ? 5 GLY A N 1 5: ATOM 34 C CA . GLY A 1 5 ? 26.628 21.486 40.103 1.00 10.86 ? 5 GLY A CA 1 5: ATOM 35 C C . GLY A 1 5 ? 26.985 22.158 38.794 1.00 11.21 ? 5 GLY A C 1 5: ATOM 36 O O . GLY A 1 5 ? 26.123 22.761 38.142 1.00 9.91 ? 5 GLY A O 1 5: ATOM 37 N N . ASN A 1 6 ? 28.277 22.142 38.475 1.00 10.41 ? 6 ASN A N 1 5: ATOM 38 C CA . ASN A 1 6 ? 28.796 22.676 37.211 1.00 11.06 ? 6 ASN A CA 1 5: ATOM 39 C C . ASN A 1 6 ? 29.117 21.435 36.378 1.00 10.33 ? 6 ASN A C 1 5: ATOM 40 O O . ASN A 1 6 ? 29.947 20.603 36.754 1.00 11.28 ? 6 ASN A O 1 5: ATOM 41 C CB . ASN A 1 6 ? 30.023 23.548 37.445 1.00 12.95 ? 6 ASN A CB 1 5: ATOM 42 C CG . ASN A 1 6 ? 29.675 24.816 38.200 1.00 18.08 ? 6 ASN A CG 1 5: ATOM 43 O OD1 . ASN A 1 6 ? 29.022 25.708 37.665 1.00 19.52 ? 6 ASN A OD1 1 5: ATOM 44 N ND2 . ASN A 1 6 ? 30.047 24.872 39.467 1.00 21.23 ? 6 ASN A ND2 1 5: ATOM 45 N N . TRP A 1 7 ? 28.399 21.289 35.272 1.00 8.66 ? 7 TRP A N 1 5: ATOM 46 C CA . TRP A 1 7 ? 28.518 20.119 34.424 1.00 8.74 ? 7 TRP A CA 1 5: ATOM 47 C C . TRP A 1 7 ? 29.246 20.352 33.092 1.00 9.63 ? 7 TRP A C 1 5: ATOM 48 O O . TRP A 1 7 ? 29.064 21.389 32.440 1.00 9.45 ? 7 TRP A O 1 5: ATOM 49 C CB . TRP A 1 7 ? 27.115 19.563 34.152 1.00 8.00 ? 7 TRP A CB 1 5: ATOM 50 C CG . TRP A 1 7 ? 26.325 19.198 35.391 1.00 8.01 ? 7 TRP A CG 1 5: ATOM 51 C CD1 . TRP A 1 7 ? 25.556 20.031 36.159 1.00 8.29 ? 7 TRP A CD1 1 5: ATOM 52 C CD2 . TRP A 1 7 ? 26.174 17.885 35.947 1.00 7.60 ? 7 TRP A CD2 1 5: ATOM 53 N NE1 . TRP A 1 7 ? 24.922 19.308 37.156 1.00 9.20 ? 7 TRP A NE1 1 5: ATOM 54 C CE2 . TRP A 1 7 ? 25.286 17.987 37.046 1.00 8.73 ? 7 TRP A CE2 1 5: ATOM 55 C CE3 . TRP A 1 7 ? 26.694 16.625 35.618 1.00 6.99 ? 7 TRP A CE3 1 5: ATOM 56 C CZ2 . TRP A 1 7 ? 24.909 16.876 37.815 1.00 7.67 ? 7 TRP A CZ2 1 5: ATOM 57 C CZ3 . TRP A 1 7 ? 26.320 15.527 36.380 1.00 7.58 ? 7 TRP A CZ3 1 5: ATOM 58 C CH2 . TRP A 1 7 ? 25.433 15.663 37.468 1.00 5.92 ? 7 TRP A CH2 1 5: ATOM 59 N N . LYS A 1 8 ? 30.052 19.368 32.702 1.00 9.39 ? 8 LYS A N 1 5: ATOM 60 C CA . LYS A 1 8 ? 30.802 19.424 31.450 1.00 11.56 ? 8 LYS A CA 1 5: ATOM 61 C C . LYS A 1 8 ? 30.342 18.243 30.611 1.00 10.56 ? 8 LYS A C 1 5: ATOM 62 O O . LYS A 1 8 ? 30.091 17.158 31.138 1.00 10.14 ? 8 LYS A O 1 5: ATOM 63 C CB . LYS A 1 8 ? 32.308 19.360 31.710 1.00 15.20 ? 8 LYS A CB 1 5: ATOM 64 C CG . LYS A 1 8 ? 32.785 18.080 32.313 1.00 18.52 ? 8 LYS A CG 1 5: ATOM 65 C CD . LYS A 1 8 ? 34.263 18.182 32.618 1.00 26.26 ? 8 LYS A CD 1 5: ATOM 66 C CE . LYS A 1 8 ? 35.091 18.499 31.378 1.00 29.22 ? 8 LYS A CE 1 5: ATOM 67 N NZ . LYS A 1 8 ? 35.067 17.393 30.369 1.00 32.48 ? 8 LYS A NZ 1 5: ATOM 68 N N . ILE A 1 9 ? 30.222 18.447 29.308 1.00 8.21 ? 9 ILE A N 1 5: ATOM 69 C CA . ILE A 1 9 ? 29.739 17.384 28.441 1.00 8.08 ? 9 ILE A CA 1 5: ATOM 70 C C . ILE A 1 9 ? 30.798 16.325 28.117 1.00 7.86 ? 9 ILE A C 1 5: ATOM 71 O O . ILE A 1 9 ? 31.990 16.635 28.028 1.00 8.38 ? 9 ILE A O 1 5: ATOM 72 C CB . ILE A 1 9 ? 29.148 17.997 27.144 1.00 10.70 ? 9 ILE A CB 1 5: ATOM 73 C CG1 . ILE A 1 9 ? 28.285 16.981 26.401 1.00 10.95 ? 9 ILE A CG1 1 5: ATOM 74 C CG2 . ILE A 1 9 ? 30.261 18.500 26.243 1.00 10.70 ? 9 ILE A CG2 1 5: ATOM 75 C CD1 . ILE A 1 9 ? 27.586 17.597 25.207 1.00 13.23 ? 9 ILE A CD1 1 5: ATOM 76 N N . ILE A 1 10 ? 30.373 15.067 27.995 1.00 7.08 ? 10 ILE A N 1 5: ATOM 77 C CA . ILE A 1 10 ? 31.288 13.988 27.656 1.00 7.45 ? 10 ILE A CA 1 5: ATOM 78 C C . ILE A 1 10 ? 30.812 13.201 26.441 1.00 8.49 ? 10 ILE A C 1 5: ATOM 79 O O . ILE A 1 10 ? 31.561 12.397 25.892 1.00 9.49 ? 10 ILE A O 1 5: ATOM 80 C CB . ILE A 1 10 ? 31.586 13.023 28.847 1.00 10.28 ? 10 ILE A CB 1 5: ATOM 81 C CG1 . ILE A 1 10 ? 30.304 12.393 29.382 1.00 10.51 ? 10 ILE A CG1 1 5: ATOM 82 C CG2 . ILE A 1 10 ? 32.349 13.756 29.963 1.00 10.10 ? 10 ILE A CG2 1 5: ATOM 83 C CD1 . ILE A 1 10 ? 30.578 11.242 30.325 1.00 12.18 ? 10 ILE A CD1 1 5: ATOM 84 N N . ARG A 1 11 ? 29.566 13.419 26.030 1.00 7.59 ? 11 ARG A N 1 5: ATOM 85 C CA . ARG A 1 11 ? 29.015 12.742 24.851 1.00 8.70 ? 11 ARG A CA 1 5: ATOM 86 C C . ARG A 1 11 ? 27.821 13.500 24.290 1.00 9.41 ? 11 ARG A C 1 5: ATOM 87 O O . ARG A 1 11 ? 26.990 14.004 25.043 1.00 9.84 ? 11 ARG A O 1 5: ATOM 88 C CB . ARG A 1 11 ? 28.563 11.316 25.184 1.00 8.07 ? 11 ARG A CB 1 5: ATOM 89 C CG . ARG A 1 11 ? 27.912 10.616 23.998 1.00 12.26 ? 11 ARG A CG 1 5: ATOM 90 C CD . ARG A 1 11 ? 27.234 9.340 24.394 1.00 13.46 ? 11 ARG A CD 1 5: ATOM 91 N NE . ARG A 1 11 ? 28.157 8.304 24.847 1.00 15.44 ? 11 ARG A NE 1 5: ATOM 92 C CZ . ARG A 1 11 ? 28.815 7.470 24.037 1.00 19.59 ? 11 ARG A CZ 1 5: ATOM 93 N NH1 . ARG A 1 11 ? 28.677 7.559 22.714 1.00 19.40 ? 11 ARG A NH1 1 5: ATOM 94 N NH2 . ARG A 1 11 ? 29.521 6.467 24.547 1.00 17.50 ? 11 ARG A NH2 1 5: ATOM 95 N N . SER A 1 12 ? 27.748 13.594 22.965 1.00 8.84 ? 12 SER A N 1 5: ATOM 96 C CA . SER A 1 12 ? 26.621 14.245 22.310 1.00 8.61 ? 12 SER A CA 1 5: ATOM 97 C C . SER A 1 12 ? 26.278 13.431 21.063 1.00 9.48 ? 12 SER A C 1 5: ATOM 98 O O . SER A 1 12 ? 27.159 13.147 20.250 1.00 9.84 ? 12 SER A O 1 5: ATOM 99 C CB . SER A 1 12 ? 26.966 15.676 21.925 1.00 9.02 ? 12 SER A CB 1 5: ATOM 100 O OG . SER A 1 12 ? 25.863 16.285 21.273 1.00 11.97 ? 12 SER A OG 1 5: ATOM 101 N N . GLU A 1 13 ? 25.016 13.038 20.924 1.00 7.59 ? 13 GLU A N 1 5: ATOM 102 C CA . GLU A 1 13 ? 24.586 12.258 19.768 1.00 9.67 ? 13 GLU A CA 1 5: ATOM 103 C C . GLU A 1 13 ? 23.368 12.887 19.118 1.00 9.06 ? 13 GLU A C 1 5: ATOM 104 O O . GLU A 1 13 ? 22.457 13.343 19.815 1.00 7.34 ? 13 GLU A O 1 5: ATOM 105 C CB . GLU A 1 13 ? 24.185 10.833 20.184 1.00 9.72 ? 13 GLU A CB 1 5: ATOM 106 C CG . GLU A 1 13 ? 25.257 10.018 20.895 1.00 15.17 ? 13 GLU A CG 1 5: ATOM 107 C CD . GLU A 1 13 ? 26.262 9.340 19.954 1.00 18.75 ? 13 GLU A CD 1 5: ATOM 108 O OE1 . GLU A 1 13 ? 26.031 9.310 18.726 1.00 18.53 ? 13 GLU A OE1 1 5: ATOM 109 O OE2 . GLU A 1 13 ? 27.286 8.822 20.457 1.00 19.23 ? 13 GLU A OE2 1 5: ATOM 110 N N . ASN A 1 14 ? 23.363 12.919 17.786 1.00 8.79 ? 14 ASN A N 1 5: ATOM 111 C CA . ASN A 1 14 ? 22.202 13.408 17.025 1.00 8.29 ? 14 ASN A CA 1 5: ATOM 112 C C . ASN A 1 14 ? 21.813 14.896 17.153 1.00 7.35 ? 14 ASN A C 1 5: ATOM 113 O O . ASN A 1 14 ? 20.681 15.245 16.860 1.00 7.00 ? 14 ASN A O 1 5: ATOM 114 C CB . ASN A 1 14 ? 20.989 12.522 17.383 1.00 7.23 ? 14 ASN A CB 1 5: ATOM 115 C CG . ASN A 1 14 ? 20.358 11.833 16.172 1.00 9.38 ? 14 ASN A CG 1 5: ATOM 116 O OD1 . ASN A 1 14 ? 20.996 11.670 15.128 1.00 10.37 ? 14 ASN A OD1 1 5: ATOM 117 N ND2 . ASN A 1 14 ? 19.106 11.436 16.310 1.00 6.35 ? 14 ASN A ND2 1 5: ATOM 118 N N . PHE A 1 15 ? 22.734 15.777 17.536 1.00 7.26 ? 15 PHE A N 1 5: ATOM 119 C CA . PHE A 1 15 ? 22.385 17.198 17.681 1.00 9.06 ? 15 PHE A CA 1 5: ATOM 120 C C . PHE A 1 15 ? 22.041 17.878 16.358 1.00 9.15 ? 15 PHE A C 1 5: ATOM 121 O O . PHE A 1 15 ? 21.041 18.578 16.265 1.00 8.64 ? 15 PHE A O 1 5: ATOM 122 C CB . PHE A 1 15 ? 23.497 17.990 18.379 1.00 10.05 ? 15 PHE A CB 1 5: ATOM 123 C CG . PHE A 1 15 ? 23.102 19.397 18.746 1.00 10.57 ? 15 PHE A CG 1 5: ATOM 124 C CD1 . PHE A 1 15 ? 22.032 19.633 19.605 1.00 13.39 ? 15 PHE A CD1 1 5: ATOM 125 C CD2 . PHE A 1 15 ? 23.813 20.485 18.254 1.00 11.47 ? 15 PHE A CD2 1 5: ATOM 126 C CE1 . PHE A 1 15 ? 21.678 20.929 19.968 1.00 13.52 ? 15 PHE A CE1 1 5: ATOM 127 C CE2 . PHE A 1 15 ? 23.467 21.784 18.609 1.00 11.60 ? 15 PHE A CE2 1 5: ATOM 128 C CZ . PHE A 1 15 ? 22.399 22.006 19.469 1.00 13.52 ? 15 PHE A CZ 1 5: ATOM 129 N N . GLU A 1 16 ? 22.878 17.699 15.342 1.00 11.17 ? 16 GLU A N 1 5: ATOM 130 C CA . GLU A 1 16 ? 22.583 18.313 14.053 1.00 12.58 ? 16 GLU A CA 1 5: ATOM 131 C C . GLU A 1 16 ? 21.271 17.797 13.468 1.00 11.71 ? 16 GLU A C 1 5: ATOM 132 O O . GLU A 1 16 ? 20.503 18.567 12.888 1.00 12.66 ? 16 GLU A O 1 5: ATOM 133 C CB . GLU A 1 16 ? 23.711 18.081 13.060 1.00 15.91 ? 16 GLU A CB 1 5: ATOM 134 C CG . GLU A 1 16 ? 23.274 18.337 11.626 1.00 21.31 ? 16 GLU A CG 1 5: ATOM 135 C CD . GLU A 1 16 ? 24.376 18.878 10.757 1.00 25.39 ? 16 GLU A CD 1 5: ATOM 136 O OE1 . GLU A 1 16 ? 25.526 18.984 11.240 1.00 27.92 ? 16 GLU A OE1 1 5: ATOM 137 O OE2 . GLU A 1 16 ? 24.084 19.213 9.588 1.00 28.60 ? 16 GLU A OE2 1 5: ATOM 138 N N . GLU A 1 17 ? 21.018 16.497 13.619 1.00 11.67 ? 17 GLU A N 1 5: ATOM 139 C CA . GLU A 1 17 ? 19.785 15.878 13.116 1.00 13.65 ? 17 GLU A CA 1 5: ATOM 140 C C . GLU A 1 17 ? 18.529 16.490 13.767 1.00 13.48 ? 17 GLU A C 1 5: ATOM 141 O O . GLU A 1 17 ? 17.490 16.662 13.115 1.00 11.68 ? 17 GLU A O 1 5: ATOM 142 C CB . GLU A 1 17 ? 19.811 14.361 13.325 1.00 17.06 ? 17 GLU A CB 1 5: ATOM 143 C CG . GLU A 1 17 ? 20.806 13.602 12.430 1.00 23.45 ? 17 GLU A CG 1 5: ATOM 144 C CD . GLU A 1 17 ? 22.279 13.624 12.909 1.00 27.80 ? 17 GLU A CD 1 5: ATOM 145 O OE1 . GLU A 1 17 ? 22.637 14.338 13.881 1.00 26.52 ? 17 GLU A OE1 1 5: ATOM 146 O OE2 . GLU A 1 17 ? 23.097 12.897 12.291 1.00 31.80 ? 17 GLU A OE2 1 5: ATOM 147 N N . LEU A 1 18 ? 18.640 16.834 15.048 1.00 10.82 ? 18 LEU A N 1 5: ATOM 148 C CA . LEU A 1 18 ? 17.547 17.468 15.777 1.00 9.45 ? 18 LEU A CA 1 5: ATOM 149 C C . LEU A 1 18 ? 17.302 18.849 15.155 1.00 9.27 ? 18 LEU A C 1 5: ATOM 150 O O . LEU A 1 18 ? 16.153 19.246 14.927 1.00 9.04 ? 18 LEU A O 1 5: ATOM 151 C CB . LEU A 1 18 ? 17.931 17.644 17.253 1.00 9.77 ? 18 LEU A CB 1 5: ATOM 152 C CG . LEU A 1 18 ? 16.921 18.358 18.163 1.00 11.36 ? 18 LEU A CG 1 5: ATOM 153 C CD1 . LEU A 1 18 ? 15.817 17.402 18.554 1.00 13.85 ? 18 LEU A CD1 1 5: ATOM 154 C CD2 . LEU A 1 18 ? 17.616 18.876 19.409 1.00 12.69 ? 18 LEU A CD2 1 5: ATOM 155 N N . LEU A 1 19 ? 18.387 19.568 14.864 1.00 10.75 ? 19 LEU A N 1 5: ATOM 156 C CA . LEU A 1 19 ? 18.275 20.906 14.276 1.00 11.15 ? 19 LEU A CA 1 5: ATOM 157 C C . LEU A 1 19 ? 17.671 20.873 12.874 1.00 12.52 ? 19 LEU A C 1 5: ATOM 158 O O . LEU A 1 19 ? 16.932 21.777 12.485 1.00 10.05 ? 19 LEU A O 1 5: ATOM 159 C CB . LEU A 1 19 ? 19.631 21.616 14.263 1.00 12.01 ? 19 LEU A CB 1 5: ATOM 160 C CG . LEU A 1 19 ? 20.282 21.963 15.614 1.00 10.42 ? 19 LEU A CG 1 5: ATOM 161 C CD1 . LEU A 1 19 ? 21.560 22.763 15.369 1.00 13.01 ? 19 LEU A CD1 1 5: ATOM 162 C CD2 . LEU A 1 19 ? 19.312 22.742 16.513 1.00 11.45 ? 19 LEU A CD2 1 5: ATOM 163 N N . LYS A 1 20 ? 17.944 19.795 12.150 1.00 14.41 ? 20 LYS A N 1 5: ATOM 164 C CA . LYS A 1 20 ? 17.427 19.628 10.800 1.00 16.54 ? 20 LYS A CA 1 5: ATOM 165 C C . LYS A 1 20 ? 15.902 19.512 10.832 1.00 16.17 ? 20 LYS A C 1 5: ATOM 166 O O . LYS A 1 20 ? 15.201 20.164 10.053 1.00 15.90 ? 20 LYS A O 1 5: ATOM 167 C CB . LYS A 1 20 ? 18.048 18.390 10.157 1.00 20.07 ? 20 LYS A CB 1 5: ATOM 168 C CG . LYS A 1 20 ? 18.592 18.643 8.765 1.00 26.61 ? 20 LYS A CG 1 5: ATOM 169 C CD . LYS A 1 20 ? 18.960 17.349 8.027 1.00 30.95 ? 20 LYS A CD 1 5: ATOM 170 C CE . LYS A 1 20 ? 20.226 16.690 8.579 1.00 35.68 ? 20 LYS A CE 1 5: ATOM 171 N NZ . LYS A 1 20 ? 21.485 17.466 8.342 1.00 39.27 ? 20 LYS A NZ 1 5: ATOM 172 N N . VAL A 1 21 ? 15.395 18.700 11.759 1.00 15.31 ? 21 VAL A N 1 5: ATOM 173 C CA . VAL A 1 21 ? 13.958 18.508 11.927 1.00 14.41 ? 21 VAL A CA 1 5: ATOM 174 C C . VAL A 1 21 ? 13.275 19.831 12.316 1.00 15.02 ? 21 VAL A C 1 5: ATOM 175 O O . VAL A 1 21 ? 12.150 20.119 11.878 1.00 13.59 ? 21 VAL A O 1 5: ATOM 176 C CB . VAL A 1 21 ? 13.674 17.422 12.998 1.00 14.93 ? 21 VAL A CB 1 5: ATOM 177 C CG1 . VAL A 1 21 ? 12.194 17.383 13.364 1.00 17.29 ? 21 VAL A CG1 1 5: ATOM 178 C CG2 . VAL A 1 21 ? 14.115 16.082 12.482 1.00 15.09 ? 21 VAL A CG2 1 5: ATOM 179 N N . LEU A 1 22 ? 13.966 20.643 13.119 1.00 14.52 ? 22 LEU A N 1 5: ATOM 180 C CA . LEU A 1 22 ? 13.432 21.938 13.569 1.00 14.42 ? 22 LEU A CA 1 5: ATOM 181 C C . LEU A 1 22 ? 13.478 22.984 12.467 1.00 15.49 ? 22 LEU A C 1 5: ATOM 182 O O . LEU A 1 22 ? 13.038 24.115 12.666 1.00 16.81 ? 22 LEU A O 1 5: ATOM 183 C CB . LEU A 1 22 ? 14.180 22.440 14.818 1.00 13.61 ? 22 LEU A CB 1 5: ATOM 184 C CG . LEU A 1 22 ? 13.986 21.565 16.069 1.00 13.97 ? 22 LEU A CG 1 5: ATOM 185 C CD1 . LEU A 1 22 ? 14.852 22.047 17.225 1.00 13.25 ? 22 LEU A CD1 1 5: ATOM 186 C CD2 . LEU A 1 22 ? 12.525 21.580 16.467 1.00 14.62 ? 22 LEU A CD2 1 5: ATOM 187 N N . GLY A 1 23 ? 14.062 22.618 11.328 1.00 16.41 ? 23 GLY A N 1 5: ATOM 188 C CA . GLY A 1 23 ? 14.123 23.516 10.183 1.00 17.05 ? 23 GLY A CA 1 5: ATOM 189 C C . GLY A 1 23 ? 15.241 24.539 10.125 1.00 18.00 ? 23 GLY A C 1 5: ATOM 190 O O . GLY A 1 23 ? 15.112 25.545 9.425 1.00 19.45 ? 23 GLY A O 1 5: ATOM 191 N N . VAL A 1 24 ? 16.320 24.315 10.869 1.00 14.78 ? 24 VAL A N 1 5: ATOM 192 C CA . VAL A 1 24 ? 17.440 25.241 10.860 1.00 13.71 ? 24 VAL A CA 1 5: ATOM 193 C C . VAL A 1 24 ? 18.289 24.983 9.607 1.00 15.09 ? 24 VAL A C 1 5: ATOM 194 O O . VAL A 1 24 ? 18.679 23.840 9.334 1.00 14.12 ? 24 VAL A O 1 5: ATOM 195 C CB . VAL A 1 24 ? 18.297 25.081 12.139 1.00 12.19 ? 24 VAL A CB 1 5: ATOM 196 C CG1 . VAL A 1 24 ? 19.465 26.054 12.109 1.00 8.69 ? 24 VAL A CG1 1 5: ATOM 197 C CG2 . VAL A 1 24 ? 17.416 25.294 13.388 1.00 11.37 ? 24 VAL A CG2 1 5: ATOM 198 N N . ASN A 1 25 ? 18.595 26.047 8.866 1.00 15.37 ? 25 ASN A N 1 5: ATOM 199 C CA . ASN A 1 25 ? 19.360 25.914 7.635 1.00 17.74 ? 25 ASN A CA 1 5: ATOM 200 C C . ASN A 1 25 ? 20.808 25.466 7.819 1.00 18.29 ? 25 ASN A C 1 5: ATOM 201 O O . ASN A 1 25 ? 21.377 25.592 8.903 1.00 18.05 ? 25 ASN A O 1 5: ATOM 202 C CB . ASN A 1 25 ? 19.230 27.172 6.742 1.00 19.41 ? 25 ASN A CB 1 5: ATOM 203 C CG . ASN A 1 25 ? 20.090 28.351 7.200 1.00 22.35 ? 25 ASN A CG 1 5: ATOM 204 O OD1 . ASN A 1 25 ? 21.207 28.189 7.698 1.00 22.64 ? 25 ASN A OD1 1 5: ATOM 205 N ND2 . ASN A 1 25 ? 19.602 29.558 6.933 1.00 24.15 ? 25 ASN A ND2 1 5: ATOM 206 N N . VAL A 1 26 ? 21.398 24.971 6.733 1.00 18.67 ? 26 VAL A N 1 5: ATOM 207 C CA . VAL A 1 26 ? 22.755 24.444 6.742 1.00 19.24 ? 26 VAL A CA 1 5: ATOM 208 C C . VAL A 1 26 ? 23.825 25.280 7.421 1.00 18.39 ? 26 VAL A C 1 5: ATOM 209 O O . VAL A 1 26 ? 24.558 24.764 8.261 1.00 18.50 ? 26 VAL A O 1 5: ATOM 210 C CB . VAL A 1 26 ? 23.223 24.088 5.320 1.00 20.77 ? 26 VAL A CB 1 5: ATOM 211 C CG1 . VAL A 1 26 ? 24.624 23.523 5.378 1.00 22.39 ? 26 VAL A CG1 1 5: ATOM 212 C CG2 . VAL A 1 26 ? 22.276 23.084 4.698 1.00 21.28 ? 26 VAL A CG2 1 5: ATOM 213 N N . MET A 1 27 ? 23.932 26.556 7.052 1.00 19.00 ? 27 MET A N 1 5: ATOM 214 C CA . MET A 1 27 ? 24.948 27.433 7.628 1.00 19.54 ? 27 MET A CA 1 5: ATOM 215 C C . MET A 1 27 ? 24.734 27.741 9.099 1.00 19.04 ? 27 MET A C 1 5: ATOM 216 O O . MET A 1 27 ? 25.702 27.820 9.849 1.00 18.28 ? 27 MET A O 1 5: ATOM 217 C CB . MET A 1 27 ? 25.104 28.736 6.830 1.00 23.31 ? 27 MET A CB 1 5: ATOM 218 C CG . MET A 1 27 ? 25.955 28.602 5.552 1.00 29.99 ? 27 MET A CG 1 5: ATOM 219 S SD . MET A 1 27 ? 24.975 28.527 4.010 1.00 37.48 ? 27 MET A SD 1 5: ATOM 220 C CE . MET A 1 27 ? 26.198 29.150 2.776 1.00 35.24 ? 27 MET A CE 1 5: ATOM 221 N N . LEU A 1 28 ? 23.480 27.932 9.507 1.00 16.74 ? 28 LEU A N 1 5: ATOM 222 C CA . LEU A 1 28 ? 23.190 28.209 10.912 1.00 16.39 ? 28 LEU A CA 1 5: ATOM 223 C C . LEU A 1 28 ? 23.477 26.954 11.722 1.00 16.86 ? 28 LEU A C 1 5: ATOM 224 O O . LEU A 1 28 ? 23.954 27.038 12.852 1.00 15.09 ? 28 LEU A O 1 5: ATOM 225 C CB . LEU A 1 28 ? 21.739 28.679 11.111 1.00 15.94 ? 28 LEU A CB 1 5: ATOM 226 C CG . LEU A 1 28 ? 21.490 30.154 10.741 1.00 16.72 ? 28 LEU A CG 1 5: ATOM 227 C CD1 . LEU A 1 28 ? 20.008 30.496 10.780 1.00 14.38 ? 28 LEU A CD1 1 5: ATOM 228 C CD2 . LEU A 1 28 ? 22.302 31.074 11.665 1.00 12.81 ? 28 LEU A CD2 1 5: ATOM 229 N N . ARG A 1 29 ? 23.228 25.791 11.121 1.00 16.05 ? 29 ARG A N 1 5: ATOM 230 C CA . ARG A 1 29 ? 23.498 24.524 11.798 1.00 18.43 ? 29 ARG A CA 1 5: ATOM 231 C C . ARG A 1 29 ? 24.980 24.377 12.076 1.00 19.22 ? 29 ARG A C 1 5: ATOM 232 O O . ARG A 1 29 ? 25.383 23.987 13.171 1.00 17.97 ? 29 ARG A O 1 5: ATOM 233 C CB . ARG A 1 29 ? 23.030 23.334 10.969 1.00 18.63 ? 29 ARG A CB 1 5: ATOM 234 C CG . ARG A 1 29 ? 21.596 22.983 11.189 1.00 21.26 ? 29 ARG A CG 1 5: ATOM 235 C CD . ARG A 1 29 ? 21.339 21.572 10.739 1.00 24.71 ? 29 ARG A CD 1 5: ATOM 236 N NE . ARG A 1 29 ? 20.571 21.564 9.513 1.00 29.88 ? 29 ARG A NE 1 5: ATOM 237 C CZ . ARG A 1 29 ? 21.019 21.147 8.340 1.00 29.19 ? 29 ARG A CZ 1 5: ATOM 238 N NH1 . ARG A 1 29 ? 22.248 20.682 8.205 1.00 30.52 ? 29 ARG A NH1 1 5: ATOM 239 N NH2 . ARG A 1 29 ? 20.232 21.233 7.295 1.00 31.61 ? 29 ARG A NH2 1 5: ATOM 240 N N . LYS A 1 30 ? 25.790 24.709 11.078 1.00 19.76 ? 30 LYS A N 1 5: ATOM 241 C CA . LYS A 1 30 ? 27.235 24.619 11.198 1.00 21.96 ? 30 LYS A CA 1 5: ATOM 242 C C . LYS A 1 30 ? 27.706 25.418 12.417 1.00 20.91 ? 30 LYS A C 1 5: ATOM 243 O O . LYS A 1 30 ? 28.470 24.916 13.239 1.00 22.15 ? 30 LYS A O 1 5: ATOM 244 C CB . LYS A 1 30 ? 27.894 25.143 9.915 1.00 25.07 ? 30 LYS A CB 1 5: ATOM 245 C CG . LYS A 1 30 ? 29.404 25.031 9.905 1.00 30.48 ? 30 LYS A CG 1 5: ATOM 246 C CD . LYS A 1 30 ? 30.013 25.631 8.639 1.00 35.43 ? 30 LYS A CD 1 5: ATOM 247 C CE . LYS A 1 30 ? 31.533 25.759 8.778 1.00 37.96 ? 30 LYS A CE 1 5: ATOM 248 N NZ . LYS A 1 30 ? 32.180 26.388 7.584 1.00 41.61 ? 30 LYS A NZ 1 5: ATOM 249 N N . ILE A 1 31 ? 27.208 26.643 12.544 1.00 18.38 ? 31 ILE A N 1 5: ATOM 250 C CA . ILE A 1 31 ? 27.557 27.527 13.652 1.00 16.41 ? 31 ILE A CA 1 5: ATOM 251 C C . ILE A 1 31 ? 27.105 26.932 14.989 1.00 15.39 ? 31 ILE A C 1 5: ATOM 252 O O . ILE A 1 31 ? 27.888 26.855 15.930 1.00 14.90 ? 31 ILE A O 1 5: ATOM 253 C CB . ILE A 1 31 ? 26.881 28.920 13.471 1.00 16.63 ? 31 ILE A CB 1 5: ATOM 254 C CG1 . ILE A 1 31 ? 27.419 29.606 12.208 1.00 18.74 ? 31 ILE A CG1 1 5: ATOM 255 C CG2 . ILE A 1 31 ? 27.071 29.791 14.713 1.00 15.71 ? 31 ILE A CG2 1 5: ATOM 256 C CD1 . ILE A 1 31 ? 26.735 30.946 11.858 1.00 17.27 ? 31 ILE A CD1 1 5: ATOM 257 N N . ALA A 1 32 ? 25.853 26.487 15.048 1.00 13.39 ? 32 ALA A N 1 5: ATOM 258 C CA . ALA A 1 32 ? 25.271 25.930 16.267 1.00 12.76 ? 32 ALA A CA 1 5: ATOM 259 C C . ALA A 1 32 ? 25.994 24.685 16.775 1.00 12.11 ? 32 ALA A C 1 5: ATOM 260 O O . ALA A 1 32 ? 26.325 24.598 17.946 1.00 10.54 ? 32 ALA A O 1 5: ATOM 261 C CB . ALA A 1 32 ? 23.790 25.638 16.040 1.00 12.45 ? 32 ALA A CB 1 5: ATOM 262 N N . VAL A 1 33 ? 26.252 23.731 15.886 1.00 11.95 ? 33 VAL A N 1 5: ATOM 263 C CA . VAL A 1 33 ? 26.932 22.490 16.256 1.00 13.80 ? 33 VAL A CA 1 5: ATOM 264 C C . VAL A 1 33 ? 28.328 22.701 16.855 1.00 14.00 ? 33 VAL A C 1 5: ATOM 265 O O . VAL A 1 33 ? 28.693 22.048 17.832 1.00 14.07 ? 33 VAL A O 1 5: ATOM 266 C CB . VAL A 1 33 ? 27.016 21.504 15.044 1.00 13.56 ? 33 VAL A CB 1 5: ATOM 267 C CG1 . VAL A 1 33 ? 27.909 20.318 15.375 1.00 16.07 ? 33 VAL A CG1 1 5: ATOM 268 C CG2 . VAL A 1 33 ? 25.621 21.006 14.684 1.00 14.96 ? 33 VAL A CG2 1 5: ATOM 269 N N . ALA A 1 34 ? 29.101 23.620 16.281 1.00 14.73 ? 34 ALA A N 1 5: ATOM 270 C CA . ALA A 1 34 ? 30.443 23.898 16.780 1.00 14.95 ? 34 ALA A CA 1 5: ATOM 271 C C . ALA A 1 34 ? 30.381 24.505 18.178 1.00 15.59 ? 34 ALA A C 1 5: ATOM 272 O O . ALA A 1 34 ? 31.120 24.085 19.065 1.00 16.65 ? 34 ALA A O 1 5: ATOM 273 C CB . ALA A 1 34 ? 31.191 24.844 15.833 1.00 16.10 ? 34 ALA A CB 1 5: ATOM 274 N N . ALA A 1 35 ? 29.495 25.480 18.375 1.00 13.20 ? 35 ALA A N 1 5: ATOM 275 C CA . ALA A 1 35 ? 29.371 26.134 19.671 1.00 13.04 ? 35 ALA A CA 1 5: ATOM 276 C C . ALA A 1 35 ? 28.807 25.200 20.749 1.00 12.91 ? 35 ALA A C 1 5: ATOM 277 O O . ALA A 1 35 ? 29.245 25.239 21.895 1.00 12.32 ? 35 ALA A O 1 5: ATOM 278 C CB . ALA A 1 35 ? 28.517 27.387 19.552 1.00 12.14 ? 35 ALA A CB 1 5: ATOM 279 N N . ALA A 1 36 ? 27.878 24.332 20.362 1.00 11.40 ? 36 ALA A N 1 5: ATOM 280 C CA . ALA A 1 36 ? 27.253 23.416 21.312 1.00 12.63 ? 36 ALA A CA 1 5: ATOM 281 C C . ALA A 1 36 ? 28.128 22.256 21.770 1.00 13.40 ? 36 ALA A C 1 5: ATOM 282 O O . ALA A 1 36 ? 27.743 21.512 22.668 1.00 13.47 ? 36 ALA A O 1 5: ATOM 283 C CB . ALA A 1 36 ? 25.952 22.883 20.744 1.00 11.79 ? 36 ALA A CB 1 5: ATOM 284 N N . SER A 1 37 ? 29.286 22.080 21.148 1.00 13.86 ? 37 SER A N 1 5: ATOM 285 C CA . SER A 1 37 ? 30.169 20.983 21.520 1.00 15.95 ? 37 SER A CA 1 5: ATOM 286 C C . SER A 1 37 ? 30.938 21.245 22.818 1.00 16.46 ? 37 SER A C 1 5: ATOM 287 O O . SER A 1 37 ? 31.488 20.320 23.406 1.00 18.23 ? 37 SER A O 1 5: ATOM 288 C CB . SER A 1 37 ? 31.145 20.689 20.388 1.00 16.93 ? 37 SER A CB 1 5: ATOM 289 O OG . SER A 1 37 ? 32.100 21.729 20.293 1.00 21.65 ? 37 SER A OG 1 5: ATOM 290 N N . LYS A 1 38 ? 30.957 22.496 23.272 1.00 16.91 ? 38 LYS A N 1 5: ATOM 291 C CA . LYS A 1 38 ? 31.657 22.869 24.502 1.00 18.36 ? 38 LYS A CA 1 5: ATOM 292 C C . LYS A 1 38 ? 30.817 23.809 25.382 1.00 15.90 ? 38 LYS A C 1 5: ATOM 293 O O . LYS A 1 38 ? 31.175 24.975 25.591 1.00 16.72 ? 38 LYS A O 1 5: ATOM 294 C CB . LYS A 1 38 ? 33.004 23.539 24.156 1.00 23.99 ? 38 LYS A CB 1 5: ATOM 295 C CG . LYS A 1 38 ? 32.907 24.607 23.046 1.00 30.97 ? 38 LYS A CG 1 5: ATOM 296 C CD . LYS A 1 38 ? 34.250 25.320 22.792 1.00 36.44 ? 38 LYS A CD 1 5: ATOM 297 C CE . LYS A 1 38 ? 34.266 26.098 21.456 1.00 38.70 ? 38 LYS A CE 1 5: ATOM 298 N NZ . LYS A 1 38 ? 33.193 27.131 21.321 1.00 39.37 ? 38 LYS A NZ 1 5: ATOM 299 N N . PRO A 1 39 ? 29.669 23.321 25.906 1.00 13.53 ? 39 PRO A N 1 5: ATOM 300 C CA . PRO A 1 39 ? 28.851 24.201 26.747 1.00 11.87 ? 39 PRO A CA 1 5: ATOM 301 C C . PRO A 1 39 ? 29.292 24.248 28.211 1.00 12.05 ? 39 PRO A C 1 5: ATOM 302 O O . PRO A 1 39 ? 30.027 23.380 28.676 1.00 12.12 ? 39 PRO A O 1 5: ATOM 303 C CB . PRO A 1 39 ? 27.469 23.560 26.649 1.00 9.34 ? 39 PRO A CB 1 5: ATOM 304 C CG . PRO A 1 39 ? 27.779 22.131 26.593 1.00 10.32 ? 39 PRO A CG 1 5: ATOM 305 C CD . PRO A 1 39 ? 29.009 22.020 25.703 1.00 10.86 ? 39 PRO A CD 1 5: ATOM 306 N N . ALA A 1 40 ? 28.921 25.316 28.898 1.00 11.52 ? 40 ALA A N 1 5: ATOM 307 C CA . ALA A 1 40 ? 29.192 25.423 30.329 1.00 11.84 ? 40 ALA A CA 1 5: ATOM 308 C C . ALA A 1 40 ? 27.773 25.329 30.894 1.00 10.23 ? 40 ALA A C 1 5: ATOM 309 O O . ALA A 1 40 ? 26.894 26.080 30.478 1.00 10.42 ? 40 ALA A O 1 5: ATOM 310 C CB . ALA A 1 40 ? 29.830 26.767 30.673 1.00 11.40 ? 40 ALA A CB 1 5: ATOM 311 N N . VAL A 1 41 ? 27.518 24.345 31.750 1.00 10.73 ? 41 VAL A N 1 5: ATOM 312 C CA . VAL A 1 41 ? 26.185 24.169 32.333 1.00 9.92 ? 41 VAL A CA 1 5: ATOM 313 C C . VAL A 1 41 ? 26.226 24.295 33.854 1.00 11.64 ? 41 VAL A C 1 5: ATOM 314 O O . VAL A 1 41 ? 27.026 23.627 34.514 1.00 11.40 ? 41 VAL A O 1 5: ATOM 315 C CB . VAL A 1 41 ? 25.594 22.772 31.987 1.00 10.67 ? 41 VAL A CB 1 5: ATOM 316 C CG1 . VAL A 1 41 ? 24.204 22.596 32.612 1.00 11.34 ? 41 VAL A CG1 1 5: ATOM 317 C CG2 . VAL A 1 41 ? 25.507 22.583 30.475 1.00 11.31 ? 41 VAL A CG2 1 5: ATOM 318 N N . GLU A 1 42 ? 25.364 25.147 34.399 1.00 10.94 ? 42 GLU A N 1 5: ATOM 319 C CA . GLU A 1 42 ? 25.271 25.327 35.845 1.00 12.40 ? 42 GLU A CA 1 5: ATOM 320 C C . GLU A 1 42 ? 23.837 25.095 36.316 1.00 11.42 ? 42 GLU A C 1 5: ATOM 321 O O . GLU A 1 42 ? 22.898 25.720 35.825 1.00 10.46 ? 42 GLU A O 1 5: ATOM 322 C CB . GLU A 1 42 ? 25.711 26.721 36.270 1.00 16.26 ? 42 GLU A CB 1 5: ATOM 323 C CG . GLU A 1 42 ? 25.495 26.947 37.768 1.00 23.78 ? 42 GLU A CG 1 5: ATOM 324 C CD . GLU A 1 42 ? 25.944 28.311 38.242 1.00 27.94 ? 42 GLU A CD 1 5: ATOM 325 O OE1 . GLU A 1 42 ? 25.308 29.329 37.872 1.00 29.92 ? 42 GLU A OE1 1 5: ATOM 326 O OE2 . GLU A 1 42 ? 26.935 28.351 39.002 1.00 32.64 ? 42 GLU A OE2 1 5: ATOM 327 N N . ILE A 1 43 ? 23.673 24.176 37.261 1.00 10.55 ? 43 ILE A N 1 5: ATOM 328 C CA . ILE A 1 43 ? 22.362 23.864 37.794 1.00 10.69 ? 43 ILE A CA 1 5: ATOM 329 C C . ILE A 1 43 ? 22.360 24.120 39.300 1.00 11.07 ? 43 ILE A C 1 5: ATOM 330 O O . ILE A 1 43 ? 23.307 23.764 39.992 1.00 10.83 ? 43 ILE A O 1 5: ATOM 331 C CB . ILE A 1 43 ? 21.996 22.374 37.552 1.00 10.47 ? 43 ILE A CB 1 5: ATOM 332 C CG1 . ILE A 1 43 ? 21.974 22.072 36.056 1.00 10.46 ? 43 ILE A CG1 1 5: ATOM 333 C CG2 . ILE A 1 43 ? 20.636 22.031 38.186 1.00 10.34 ? 43 ILE A CG2 1 5: ATOM 334 C CD1 . ILE A 1 43 ? 21.607 20.639 35.726 1.00 9.00 ? 43 ILE A CD1 1 5: ATOM 335 N N . LYS A 1 44 ? 21.315 24.784 39.778 1.00 12.26 ? 44 LYS A N 1 5: ATOM 336 C CA . LYS A 1 44 ? 21.127 25.051 41.201 1.00 13.96 ? 44 LYS A CA 1 5: ATOM 337 C C . LYS A 1 44 ? 19.729 24.528 41.516 1.00 14.16 ? 44 LYS A C 1 5: ATOM 338 O O . LYS A 1 44 ? 18.749 24.920 40.873 1.00 14.12 ? 44 LYS A O 1 5: ATOM 339 C CB . LYS A 1 44 ? 21.220 26.545 41.503 1.00 16.58 ? 44 LYS A CB 1 5: ATOM 340 C CG . LYS A 1 44 ? 22.580 27.150 41.170 1.00 22.90 ? 44 LYS A CG 1 5: ATOM 341 C CD . LYS A 1 44 ? 22.571 28.654 41.385 1.00 29.01 ? 44 LYS A CD 1 5: ATOM 342 C CE . LYS A 1 44 ? 23.890 29.293 40.982 1.00 31.56 ? 44 LYS A CE 1 5: ATOM 343 N NZ . LYS A 1 44 ? 23.818 30.781 41.111 1.00 34.70 ? 44 LYS A NZ 1 5: ATOM 344 N N . GLN A 1 45 ? 19.649 23.594 42.460 1.00 15.66 ? 45 GLN A N 1 5: ATOM 345 C CA . GLN A 1 45 ? 18.377 22.993 42.852 1.00 16.03 ? 45 GLN A CA 1 5: ATOM 346 C C . GLN A 1 45 ? 18.098 23.182 44.342 1.00 17.60 ? 45 GLN A C 1 5: ATOM 347 O O . GLN A 1 45 ? 18.989 23.024 45.164 1.00 17.17 ? 45 GLN A O 1 5: ATOM 348 C CB . GLN A 1 45 ? 18.397 21.498 42.544 1.00 15.51 ? 45 GLN A CB 1 5: ATOM 349 C CG . GLN A 1 45 ? 17.168 20.744 43.015 1.00 13.62 ? 45 GLN A CG 1 5: ATOM 350 C CD . GLN A 1 45 ? 17.312 19.256 42.838 1.00 15.68 ? 45 GLN A CD 1 5: ATOM 351 O OE1 . GLN A 1 45 ? 18.348 18.769 42.397 1.00 18.84 ? 45 GLN A OE1 1 5: ATOM 352 N NE2 . GLN A 1 45 ? 16.276 18.521 43.177 1.00 16.73 ? 45 GLN A NE2 1 5: ATOM 353 N N . GLU A 1 46 ? 16.868 23.551 44.670 1.00 18.48 ? 46 GLU A N 1 5: ATOM 354 C CA . GLU A 1 46 ? 16.441 23.718 46.062 1.00 21.26 ? 46 GLU A CA 1 5: ATOM 355 C C . GLU A 1 46 ? 15.108 23.004 46.105 1.00 19.06 ? 46 GLU A C 1 5: ATOM 356 O O . GLU A 1 46 ? 14.080 23.589 45.784 1.00 20.08 ? 46 GLU A O 1 5: ATOM 357 C CB . GLU A 1 46 ? 16.239 25.194 46.408 1.00 26.45 ? 46 GLU A CB 1 5: ATOM 358 C CG . GLU A 1 46 ? 17.284 25.787 47.361 1.00 37.46 ? 46 GLU A CG 1 5: ATOM 359 C CD . GLU A 1 46 ? 17.093 25.374 48.832 1.00 42.24 ? 46 GLU A CD 1 5: ATOM 360 O OE1 . GLU A 1 46 ? 16.192 25.944 49.501 1.00 44.05 ? 46 GLU A OE1 1 5: ATOM 361 O OE2 . GLU A 1 46 ? 17.867 24.507 49.320 1.00 44.14 ? 46 GLU A OE2 1 5: ATOM 362 N N . GLY A 1 47 ? 15.131 21.720 46.429 1.00 18.35 ? 47 GLY A N 1 5: ATOM 363 C CA . GLY A 1 47 ? 13.893 20.970 46.463 1.00 18.96 ? 47 GLY A CA 1 5: ATOM 364 C C . GLY A 1 47 ? 13.382 20.755 45.053 1.00 18.27 ? 47 GLY A C 1 5: ATOM 365 O O . GLY A 1 47 ? 14.067 20.157 44.238 1.00 18.05 ? 47 GLY A O 1 5: ATOM 366 N N . ASP A 1 48 ? 12.194 21.262 44.755 1.00 16.66 ? 48 ASP A N 1 5: ATOM 367 C CA . ASP A 1 48 ? 11.617 21.107 43.420 1.00 16.86 ? 48 ASP A CA 1 5: ATOM 368 C C . ASP A 1 48 ? 11.771 22.378 42.566 1.00 15.92 ? 48 ASP A C 1 5: ATOM 369 O O . ASP A 1 48 ? 11.139 22.511 41.504 1.00 14.50 ? 48 ASP A O 1 5: ATOM 370 C CB . ASP A 1 48 ? 10.136 20.694 43.513 1.00 19.00 ? 48 ASP A CB 1 5: ATOM 371 C CG . ASP A 1 48 ? 9.943 19.221 43.897 1.00 21.49 ? 48 ASP A CG 1 5: ATOM 372 O OD1 . ASP A 1 48 ? 10.901 18.406 43.840 1.00 23.51 ? 48 ASP A OD1 1 5: ATOM 373 O OD2 . ASP A 1 48 ? 8.802 18.868 44.243 1.00 25.04 ? 48 ASP A OD2 1 5: ATOM 374 N N . THR A 1 49 ? 12.610 23.299 43.042 1.00 13.75 ? 49 THR A N 1 5: ATOM 375 C CA . THR A 1 49 ? 12.870 24.551 42.348 1.00 13.82 ? 49 THR A CA 1 5: ATOM 376 C C . THR A 1 49 ? 14.231 24.460 41.678 1.00 13.22 ? 49 THR A C 1 5: ATOM 377 O O . THR A 1 49 ? 15.235 24.152 42.322 1.00 12.56 ? 49 THR A O 1 5: ATOM 378 C CB . THR A 1 49 ? 12.847 25.741 43.316 1.00 16.10 ? 49 THR A CB 1 5: ATOM 379 O OG1 . THR A 1 49 ? 11.556 25.815 43.941 1.00 17.94 ? 49 THR A OG1 1 5: ATOM 380 C CG2 . THR A 1 49 ? 13.100 27.037 42.571 1.00 16.15 ? 49 THR A CG2 1 5: ATOM 381 N N . PHE A 1 50 ? 14.266 24.794 40.392 1.00 12.20 ? 50 PHE A N 1 5: ATOM 382 C CA . PHE A 1 50 ? 15.485 24.704 39.602 1.00 10.82 ? 50 PHE A CA 1 5: ATOM 383 C C . PHE A 1 50 ? 15.842 25.979 38.855 1.00 10.40 ? 50 PHE A C 1 5: ATOM 384 O O . PHE A 1 50 ? 14.968 26.758 38.460 1.00 9.90 ? 50 PHE A O 1 5: ATOM 385 C CB . PHE A 1 50 ? 15.338 23.591 38.547 1.00 10.78 ? 50 PHE A CB 1 5: ATOM 386 C CG . PHE A 1 50 ? 15.316 22.192 39.107 1.00 13.13 ? 50 PHE A CG 1 5: ATOM 387 C CD1 . PHE A 1 50 ? 14.146 21.653 39.634 1.00 11.97 ? 50 PHE A CD1 1 5: ATOM 388 C CD2 . PHE A 1 50 ? 16.464 21.401 39.079 1.00 14.34 ? 50 PHE A CD2 1 5: ATOM 389 C CE1 . PHE A 1 50 ? 14.113 20.367 40.120 1.00 12.69 ? 50 PHE A CE1 1 5: ATOM 390 C CE2 . PHE A 1 50 ? 16.439 20.098 39.569 1.00 14.64 ? 50 PHE A CE2 1 5: ATOM 391 C CZ . PHE A 1 50 ? 15.258 19.582 40.092 1.00 13.15 ? 50 PHE A CZ 1 5: ATOM 392 N N . TYR A 1 51 ? 17.147 26.165 38.678 1.00 10.37 ? 51 TYR A N 1 5: ATOM 393 C CA . TYR A 1 51 ? 17.709 27.258 37.910 1.00 10.95 ? 51 TYR A CA 1 5: ATOM 394 C C . TYR A 1 51 ? 18.714 26.513 37.039 1.00 9.84 ? 51 TYR A C 1 5: ATOM 395 O O . TYR A 1 51 ? 19.540 25.761 37.547 1.00 9.78 ? 51 TYR A O 1 5: ATOM 396 C CB . TYR A 1 51 ? 18.436 28.284 38.790 1.00 12.57 ? 51 TYR A CB 1 5: ATOM 397 C CG . TYR A 1 51 ? 19.396 29.178 38.014 1.00 12.91 ? 51 TYR A CG 1 5: ATOM 398 C CD1 . TYR A 1 51 ? 18.939 30.302 37.327 1.00 15.83 ? 51 TYR A CD1 1 5: ATOM 399 C CD2 . TYR A 1 51 ? 20.762 28.896 37.974 1.00 14.05 ? 51 TYR A CD2 1 5: ATOM 400 C CE1 . TYR A 1 51 ? 19.822 31.126 36.621 1.00 16.52 ? 51 TYR A CE1 1 5: ATOM 401 C CE2 . TYR A 1 51 ? 21.655 29.705 37.275 1.00 14.62 ? 51 TYR A CE2 1 5: ATOM 402 C CZ . TYR A 1 51 ? 21.179 30.818 36.604 1.00 16.59 ? 51 TYR A CZ 1 5: ATOM 403 O OH . TYR A 1 51 ? 22.060 31.633 35.932 1.00 17.52 ? 51 TYR A OH 1 5: ATOM 404 N N . ILE A 1 52 ? 18.610 26.676 35.726 1.00 10.57 ? 52 ILE A N 1 5: ATOM 405 C CA . ILE A 1 52 ? 19.520 26.004 34.801 1.00 9.09 ? 52 ILE A CA 1 5: ATOM 406 C C . ILE A 1 52 ? 20.066 27.020 33.801 1.00 8.55 ? 52 ILE A C 1 5: ATOM 407 O O . ILE A 1 52 ? 19.296 27.652 33.086 1.00 10.49 ? 52 ILE A O 1 5: ATOM 408 C CB . ILE A 1 52 ? 18.807 24.859 34.026 1.00 8.96 ? 52 ILE A CB 1 5: ATOM 409 C CG1 . ILE A 1 52 ? 18.242 23.814 35.013 1.00 9.15 ? 52 ILE A CG1 1 5: ATOM 410 C CG2 . ILE A 1 52 ? 19.792 24.189 33.070 1.00 10.39 ? 52 ILE A CG2 1 5: ATOM 411 C CD1 . ILE A 1 52 ? 17.585 22.616 34.366 1.00 8.10 ? 52 ILE A CD1 1 5: ATOM 412 N N . LYS A 1 53 ? 21.388 27.197 33.791 1.00 8.61 ? 53 LYS A N 1 5: ATOM 413 C CA . LYS A 1 53 ? 22.049 28.115 32.868 1.00 9.66 ? 53 LYS A CA 1 5: ATOM 414 C C . LYS A 1 53 ? 22.939 27.319 31.924 1.00 8.71 ? 53 LYS A C 1 5: ATOM 415 O O . LYS A 1 53 ? 23.815 26.583 32.362 1.00 7.58 ? 53 LYS A O 1 5: ATOM 416 C CB . LYS A 1 53 ? 22.909 29.120 33.611 1.00 10.60 ? 53 LYS A CB 1 5: ATOM 417 C CG . LYS A 1 53 ? 23.580 30.135 32.688 1.00 14.21 ? 53 LYS A CG 1 5: ATOM 418 C CD . LYS A 1 53 ? 24.496 31.006 33.505 1.00 20.27 ? 53 LYS A CD 1 5: ATOM 419 C CE . LYS A 1 53 ? 24.831 32.319 32.828 1.00 26.91 ? 53 LYS A CE 1 5: ATOM 420 N NZ . LYS A 1 53 ? 25.878 33.009 33.659 1.00 29.12 ? 53 LYS A NZ 1 5: ATOM 421 N N . THR A 1 54 ? 22.686 27.445 30.625 1.00 8.49 ? 54 THR A N 1 5: ATOM 422 C CA . THR A 1 54 ? 23.478 26.747 29.628 1.00 7.98 ? 54 THR A CA 1 5: ATOM 423 C C . THR A 1 54 ? 24.118 27.820 28.764 1.00 8.23 ? 54 THR A C 1 5: ATOM 424 O O . THR A 1 54 ? 23.433 28.584 28.087 1.00 8.40 ? 54 THR A O 1 5: ATOM 425 C CB . THR A 1 54 ? 22.621 25.817 28.789 1.00 8.33 ? 54 THR A CB 1 5: ATOM 426 O OG1 . THR A 1 54 ? 21.896 24.946 29.660 1.00 9.95 ? 54 THR A OG1 1 5: ATOM 427 C CG2 . THR A 1 54 ? 23.505 24.976 27.873 1.00 4.95 ? 54 THR A CG2 1 5: ATOM 428 N N . SER A 1 55 ? 25.444 27.840 28.758 1.00 8.75 ? 55 SER A N 1 5: ATOM 429 C CA . SER A 1 55 ? 26.171 28.865 28.047 1.00 10.50 ? 55 SER A CA 1 5: ATOM 430 C C . SER A 1 55 ? 27.116 28.382 26.950 1.00 9.24 ? 55 SER A C 1 5: ATOM 431 O O . SER A 1 55 ? 27.802 27.370 27.101 1.00 8.98 ? 55 SER A O 1 5: ATOM 432 C CB . SER A 1 55 ? 26.934 29.694 29.082 1.00 13.09 ? 55 SER A CB 1 5: ATOM 433 O OG . SER A 1 55 ? 27.781 30.646 28.473 1.00 23.11 ? 55 SER A OG 1 5: ATOM 434 N N . THR A 1 56 ? 27.091 29.094 25.825 1.00 8.86 ? 56 THR A N 1 5: ATOM 435 C CA . THR A 1 56 ? 27.978 28.831 24.684 1.00 8.05 ? 56 THR A CA 1 5: ATOM 436 C C . THR A 1 56 ? 28.393 30.215 24.138 1.00 8.09 ? 56 THR A C 1 5: ATOM 437 O O . THR A 1 56 ? 27.834 31.237 24.525 1.00 7.17 ? 56 THR A O 1 5: ATOM 438 C CB . THR A 1 56 ? 27.296 28.024 23.534 1.00 6.70 ? 56 THR A CB 1 5: ATOM 439 O OG1 . THR A 1 56 ? 26.294 28.829 22.909 1.00 9.76 ? 56 THR A OG1 1 5: ATOM 440 C CG2 . THR A 1 56 ? 26.653 26.751 24.049 1.00 7.76 ? 56 THR A CG2 1 5: ATOM 441 N N . THR A 1 57 ? 29.381 30.242 23.249 1.00 9.17 ? 57 THR A N 1 5: ATOM 442 C CA . THR A 1 57 ? 29.871 31.485 22.644 1.00 8.49 ? 57 THR A CA 1 5: ATOM 443 C C . THR A 1 57 ? 28.820 32.222 21.802 1.00 7.50 ? 57 THR A C 1 5: ATOM 444 O O . THR A 1 57 ? 28.952 33.412 21.565 1.00 9.40 ? 57 THR A O 1 5: ATOM 445 C CB . THR A 1 57 ? 31.091 31.205 21.716 1.00 9.12 ? 57 THR A CB 1 5: ATOM 446 O OG1 . THR A 1 57 ? 30.758 30.171 20.786 1.00 9.41 ? 57 THR A OG1 1 5: ATOM 447 C CG2 . THR A 1 57 ? 32.297 30.775 22.516 1.00 11.48 ? 57 THR A CG2 1 5: ATOM 448 N N . VAL A 1 58 ? 27.786 31.510 21.356 1.00 8.04 ? 58 VAL A N 1 5: ATOM 449 C CA . VAL A 1 58 ? 26.733 32.090 20.500 1.00 9.09 ? 58 VAL A CA 1 5: ATOM 450 C C . VAL A 1 58 ? 25.328 32.224 21.102 1.00 8.67 ? 58 VAL A C 1 5: ATOM 451 O O . VAL A 1 58 ? 24.466 32.892 20.531 1.00 6.97 ? 58 VAL A O 1 5: ATOM 452 C CB . VAL A 1 58 ? 26.602 31.287 19.155 1.00 9.96 ? 58 VAL A CB 1 5: ATOM 453 C CG1 . VAL A 1 58 ? 27.976 31.161 18.454 1.00 11.08 ? 58 VAL A CG1 1 5: ATOM 454 C CG2 . VAL A 1 58 ? 26.010 29.890 19.404 1.00 9.41 ? 58 VAL A CG2 1 5: ATOM 455 N N . ARG A 1 59 ? 25.100 31.620 22.266 1.00 8.88 ? 59 ARG A N 1 5: ATOM 456 C CA . ARG A 1 59 ? 23.783 31.655 22.882 1.00 9.95 ? 59 ARG A CA 1 5: ATOM 457 C C . ARG A 1 59 ? 23.843 31.140 24.303 1.00 10.14 ? 59 ARG A C 1 5: ATOM 458 O O . ARG A 1 59 ? 24.440 30.108 24.556 1.00 10.10 ? 59 ARG A O 1 5: ATOM 459 C CB . ARG A 1 59 ? 22.837 30.751 22.074 1.00 13.11 ? 59 ARG A CB 1 5: ATOM 460 C CG . ARG A 1 59 ? 21.417 30.569 22.623 1.00 16.80 ? 59 ARG A CG 1 5: ATOM 461 C CD . ARG A 1 59 ? 20.521 29.961 21.535 1.00 18.74 ? 59 ARG A CD 1 5: ATOM 462 N NE . ARG A 1 59 ? 19.250 29.440 22.032 1.00 20.63 ? 59 ARG A NE 1 5: ATOM 463 C CZ . ARG A 1 59 ? 18.147 30.165 22.193 1.00 22.94 ? 59 ARG A CZ 1 5: ATOM 464 N NH1 . ARG A 1 59 ? 18.138 31.462 21.894 1.00 22.55 ? 59 ARG A NH1 1 5: ATOM 465 N NH2 . ARG A 1 59 ? 17.051 29.594 22.686 1.00 23.68 ? 59 ARG A NH2 1 5: ATOM 466 N N . THR A 1 60 ? 23.183 31.849 25.211 1.00 11.23 ? 60 THR A N 1 5: ATOM 467 C CA . THR A 1 60 ? 23.120 31.458 26.611 1.00 11.84 ? 60 THR A CA 1 5: ATOM 468 C C . THR A 1 60 ? 21.650 31.500 27.005 1.00 11.73 ? 60 THR A C 1 5: ATOM 469 O O . THR A 1 60 ? 20.934 32.423 26.620 1.00 13.69 ? 60 THR A O 1 5: ATOM 470 C CB . THR A 1 60 ? 23.916 32.451 27.519 1.00 10.13 ? 60 THR A CB 1 5: ATOM 471 O OG1 . THR A 1 60 ? 25.320 32.302 27.276 1.00 10.55 ? 60 THR A OG1 1 5: ATOM 472 C CG2 . THR A 1 60 ? 23.632 32.181 29.003 1.00 11.01 ? 60 THR A CG2 1 5: ATOM 473 N N . THR A 1 61 ? 21.183 30.470 27.706 1.00 11.78 ? 61 THR A N 1 5: ATOM 474 C CA . THR A 1 61 ? 19.797 30.413 28.175 1.00 11.54 ? 61 THR A CA 1 5: ATOM 475 C C . THR A 1 61 ? 19.831 30.214 29.686 1.00 10.88 ? 61 THR A C 1 5: ATOM 476 O O . THR A 1 61 ? 20.734 29.570 30.205 1.00 9.63 ? 61 THR A O 1 5: ATOM 477 C CB . THR A 1 61 ? 18.965 29.229 27.539 1.00 12.65 ? 61 THR A CB 1 5: ATOM 478 O OG1 . THR A 1 61 ? 19.563 27.976 27.874 1.00 14.13 ? 61 THR A OG1 1 5: ATOM 479 C CG2 . THR A 1 61 ? 18.889 29.336 26.012 1.00 14.15 ? 61 THR A CG2 1 5: ATOM 480 N N . GLU A 1 62 ? 18.878 30.828 30.382 1.00 12.14 ? 62 GLU A N 1 5: ATOM 481 C CA . GLU A 1 62 ? 18.749 30.698 31.833 1.00 12.88 ? 62 GLU A CA 1 5: ATOM 482 C C . GLU A 1 62 ? 17.283 30.444 32.100 1.00 12.21 ? 62 GLU A C 1 5: ATOM 483 O O . GLU A 1 62 ? 16.450 31.270 31.745 1.00 13.95 ? 62 GLU A O 1 5: ATOM 484 C CB . GLU A 1 62 ? 19.151 31.990 32.538 1.00 16.15 ? 62 GLU A CB 1 5: ATOM 485 C CG . GLU A 1 62 ? 20.585 32.344 32.326 1.00 23.65 ? 62 GLU A CG 1 5: ATOM 486 C CD . GLU A 1 62 ? 20.961 33.649 32.979 1.00 29.90 ? 62 GLU A CD 1 5: ATOM 487 O OE1 . GLU A 1 62 ? 20.969 33.703 34.229 1.00 31.84 ? 62 GLU A OE1 1 5: ATOM 488 O OE2 . GLU A 1 62 ? 21.258 34.616 32.236 1.00 33.89 ? 62 GLU A OE2 1 5: ATOM 489 N N . ILE A 1 63 ? 16.943 29.292 32.657 1.00 10.43 ? 63 ILE A N 1 5: ATOM 490 C CA . ILE A 1 63 ? 15.548 29.021 32.946 1.00 11.02 ? 63 ILE A CA 1 5: ATOM 491 C C . ILE A 1 63 ? 15.352 28.816 34.446 1.00 11.60 ? 63 ILE A C 1 5: ATOM 492 O O . ILE A 1 63 ? 16.286 28.434 35.144 1.00 9.20 ? 63 ILE A O 1 5: ATOM 493 C CB . ILE A 1 63 ? 14.976 27.816 32.125 1.00 11.28 ? 63 ILE A CB 1 5: ATOM 494 C CG1 . ILE A 1 63 ? 15.717 26.519 32.431 1.00 10.60 ? 63 ILE A CG1 1 5: ATOM 495 C CG2 . ILE A 1 63 ? 15.020 28.129 30.638 1.00 11.62 ? 63 ILE A CG2 1 5: ATOM 496 C CD1 . ILE A 1 63 ? 15.126 25.293 31.720 1.00 13.40 ? 63 ILE A CD1 1 5: ATOM 497 N N . ASN A 1 64 ? 14.184 29.219 34.933 1.00 12.13 ? 64 ASN A N 1 5: ATOM 498 C CA . ASN A 1 64 ? 13.824 29.083 36.343 1.00 14.79 ? 64 ASN A CA 1 5: ATOM 499 C C . ASN A 1 64 ? 12.451 28.441 36.375 1.00 13.29 ? 64 ASN A C 1 5: ATOM 500 O O . ASN A 1 64 ? 11.490 28.976 35.802 1.00 13.29 ? 64 ASN A O 1 5: ATOM 501 C CB . ASN A 1 64 ? 13.732 30.450 37.054 1.00 16.87 ? 64 ASN A CB 1 5: ATOM 502 C CG . ASN A 1 64 ? 15.079 31.089 37.279 1.00 20.91 ? 64 ASN A CG 1 5: ATOM 503 O OD1 . ASN A 1 64 ? 15.775 30.764 38.238 1.00 22.91 ? 64 ASN A OD1 1 5: ATOM 504 N ND2 . ASN A 1 64 ? 15.459 32.007 36.393 1.00 22.20 ? 64 ASN A ND2 1 5: ATOM 505 N N . PHE A 1 65 ? 12.347 27.301 37.044 1.00 12.90 ? 65 PHE A N 1 5: ATOM 506 C CA . PHE A 1 65 ? 11.058 26.641 37.132 1.00 12.63 ? 65 PHE A CA 1 5: ATOM 507 C C . PHE A 1 65 ? 10.858 25.841 38.410 1.00 13.07 ? 65 PHE A C 1 5: ATOM 508 O O . PHE A 1 65 ? 11.811 25.531 39.121 1.00 12.50 ? 65 PHE A O 1 5: ATOM 509 C CB . PHE A 1 65 ? 10.829 25.731 35.922 1.00 11.31 ? 65 PHE A CB 1 5: ATOM 510 C CG . PHE A 1 65 ? 11.794 24.586 35.825 1.00 12.32 ? 65 PHE A CG 1 5: ATOM 511 C CD1 . PHE A 1 65 ? 11.549 23.386 36.494 1.00 10.31 ? 65 PHE A CD1 1 5: ATOM 512 C CD2 . PHE A 1 65 ? 12.947 24.706 35.070 1.00 11.23 ? 65 PHE A CD2 1 5: ATOM 513 C CE1 . PHE A 1 65 ? 12.441 22.329 36.413 1.00 11.00 ? 65 PHE A CE1 1 5: ATOM 514 C CE2 . PHE A 1 65 ? 13.847 23.645 34.984 1.00 11.69 ? 65 PHE A CE2 1 5: ATOM 515 C CZ . PHE A 1 65 ? 13.593 22.461 35.655 1.00 12.20 ? 65 PHE A CZ 1 5: ATOM 516 N N . LYS A 1 66 ? 9.599 25.560 38.713 1.00 13.15 ? 66 LYS A N 1 5: ATOM 517 C CA . LYS A 1 66 ? 9.251 24.735 39.849 1.00 13.41 ? 66 LYS A CA 1 5: ATOM 518 C C . LYS A 1 66 ? 8.555 23.552 39.178 1.00 12.17 ? 66 LYS A C 1 5: ATOM 519 O O . LYS A 1 66 ? 7.763 23.747 38.251 1.00 12.93 ? 66 LYS A O 1 5: ATOM 520 C CB . LYS A 1 66 ? 8.313 25.498 40.800 1.00 16.68 ? 66 LYS A CB 1 5: ATOM 521 C CG . LYS A 1 66 ? 7.722 24.639 41.907 1.00 24.60 ? 66 LYS A CG 1 5: ATOM 522 C CD . LYS A 1 66 ? 7.391 25.453 43.165 1.00 28.53 ? 66 LYS A CD 1 5: ATOM 523 C CE . LYS A 1 66 ? 6.664 24.585 44.213 1.00 32.17 ? 66 LYS A CE 1 5: ATOM 524 N NZ . LYS A 1 66 ? 7.393 23.332 44.604 1.00 32.54 ? 66 LYS A NZ 1 5: ATOM 525 N N . VAL A 1 67 ? 8.918 22.329 39.562 1.00 11.82 ? 67 VAL A N 1 5: ATOM 526 C CA . VAL A 1 67 ? 8.295 21.141 38.975 1.00 10.93 ? 67 VAL A CA 1 5: ATOM 527 C C . VAL A 1 67 ? 6.783 21.174 39.226 1.00 11.97 ? 67 VAL A C 1 5: ATOM 528 O O . VAL A 1 67 ? 6.343 21.480 40.342 1.00 13.54 ? 67 VAL A O 1 5: ATOM 529 C CB . VAL A 1 67 ? 8.908 19.827 39.541 1.00 10.09 ? 67 VAL A CB 1 5: ATOM 530 C CG1 . VAL A 1 67 ? 8.271 18.617 38.883 1.00 10.96 ? 67 VAL A CG1 1 5: ATOM 531 C CG2 . VAL A 1 67 ? 10.410 19.808 39.320 1.00 10.21 ? 67 VAL A CG2 1 5: ATOM 532 N N . GLY A 1 68 ? 6.006 20.965 38.160 1.00 9.80 ? 68 GLY A N 1 5: ATOM 533 C CA . GLY A 1 68 ? 4.557 20.962 38.265 1.00 9.33 ? 68 GLY A CA 1 5: ATOM 534 C C . GLY A 1 68 ? 3.887 22.298 38.031 1.00 10.60 ? 68 GLY A C 1 5: ATOM 535 O O . GLY A 1 68 ? 2.653 22.389 38.039 1.00 11.93 ? 68 GLY A O 1 5: ATOM 536 N N . GLU A 1 69 ? 4.688 23.337 37.809 1.00 11.12 ? 69 GLU A N 1 5: ATOM 537 C CA . GLU A 1 69 ? 4.165 24.682 37.553 1.00 12.64 ? 69 GLU A CA 1 5: ATOM 538 C C . GLU A 1 69 ? 4.604 25.185 36.184 1.00 13.09 ? 69 GLU A C 1 5: ATOM 539 O O . GLU A 1 69 ? 5.774 25.107 35.820 1.00 12.17 ? 69 GLU A O 1 5: ATOM 540 C CB . GLU A 1 69 ? 4.578 25.642 38.668 1.00 12.20 ? 69 GLU A CB 1 5: ATOM 541 C CG . GLU A 1 69 ? 3.857 25.282 39.964 1.00 17.44 ? 69 GLU A CG 1 5: ATOM 542 C CD . GLU A 1 69 ? 4.116 26.211 41.138 1.00 21.02 ? 69 GLU A CD 1 5: ATOM 543 O OE1 . GLU A 1 69 ? 4.496 27.384 40.945 1.00 21.43 ? 69 GLU A OE1 1 5: ATOM 544 O OE2 . GLU A 1 69 ? 3.902 25.753 42.282 1.00 23.44 ? 69 GLU A OE2 1 5: ATOM 545 N N . GLU A 1 70 ? 3.633 25.622 35.397 1.00 14.53 ? 70 GLU A N 1 5: ATOM 546 C CA . GLU A 1 70 ? 3.912 26.102 34.059 1.00 15.80 ? 70 GLU A CA 1 5: ATOM 547 C C . GLU A 1 70 ? 4.816 27.329 34.007 1.00 13.72 ? 70 GLU A C 1 5: ATOM 548 O O . GLU A 1 70 ? 4.761 28.208 34.863 1.00 13.66 ? 70 GLU A O 1 5: ATOM 549 C CB . GLU A 1 70 ? 2.606 26.359 33.320 1.00 19.99 ? 70 GLU A CB 1 5: ATOM 550 C CG . GLU A 1 70 ? 2.814 26.634 31.851 1.00 28.23 ? 70 GLU A CG 1 5: ATOM 551 C CD . GLU A 1 70 ? 1.518 26.678 31.097 1.00 32.73 ? 70 GLU A CD 1 5: ATOM 552 O OE1 . GLU A 1 70 ? 0.975 25.589 30.789 1.00 35.76 ? 70 GLU A OE1 1 5: ATOM 553 O OE2 . GLU A 1 70 ? 1.045 27.802 30.823 1.00 35.75 ? 70 GLU A OE2 1 5: ATOM 554 N N . PHE A 1 71 ? 5.713 27.340 33.028 1.00 12.80 ? 71 PHE A N 1 5: ATOM 555 C CA . PHE A 1 71 ? 6.638 28.448 32.837 1.00 12.36 ? 71 PHE A CA 1 5: ATOM 556 C C . PHE A 1 71 ? 6.856 28.678 31.350 1.00 12.97 ? 71 PHE A C 1 5: ATOM 557 O O . PHE A 1 71 ? 6.382 27.917 30.516 1.00 12.54 ? 71 PHE A O 1 5: ATOM 558 C CB . PHE A 1 71 ? 7.975 28.243 33.589 1.00 10.02 ? 71 PHE A CB 1 5: ATOM 559 C CG . PHE A 1 71 ? 8.851 27.148 33.033 1.00 10.48 ? 71 PHE A CG 1 5: ATOM 560 C CD1 . PHE A 1 71 ? 8.549 25.815 33.256 1.00 9.95 ? 71 PHE A CD1 1 5: ATOM 561 C CD2 . PHE A 1 71 ? 10.006 27.459 32.331 1.00 9.29 ? 71 PHE A CD2 1 5: ATOM 562 C CE1 . PHE A 1 71 ? 9.380 24.811 32.793 1.00 9.74 ? 71 PHE A CE1 1 5: ATOM 563 C CE2 . PHE A 1 71 ? 10.832 26.464 31.868 1.00 9.51 ? 71 PHE A CE2 1 5: ATOM 564 C CZ . PHE A 1 71 ? 10.518 25.136 32.102 1.00 8.47 ? 71 PHE A CZ 1 5: ATOM 565 N N . GLU A 1 72 ? 7.581 29.733 31.028 1.00 15.04 ? 72 GLU A N 1 5: ATOM 566 C CA . GLU A 1 72 ? 7.826 30.063 29.644 1.00 17.19 ? 72 GLU A CA 1 5: ATOM 567 C C . GLU A 1 72 ? 9.323 30.036 29.357 1.00 15.53 ? 72 GLU A C 1 5: ATOM 568 O O . GLU A 1 72 ? 10.130 30.511 30.158 1.00 16.16 ? 72 GLU A O 1 5: ATOM 569 C CB . GLU A 1 72 ? 7.248 31.448 29.379 1.00 22.03 ? 72 GLU A CB 1 5: ATOM 570 C CG . GLU A 1 72 ? 6.700 31.658 28.002 1.00 30.80 ? 72 GLU A CG 1 5: ATOM 571 C CD . GLU A 1 72 ? 6.157 33.060 27.827 1.00 34.75 ? 72 GLU A CD 1 5: ATOM 572 O OE1 . GLU A 1 72 ? 5.014 33.309 28.276 1.00 35.88 ? 72 GLU A OE1 1 5: ATOM 573 O OE2 . GLU A 1 72 ? 6.885 33.912 27.255 1.00 38.91 ? 72 GLU A OE2 1 5: ATOM 574 N N . GLU A 1 73 ? 9.691 29.378 28.263 1.00 13.46 ? 73 GLU A N 1 5: ATOM 575 C CA . GLU A 1 73 ? 11.088 29.302 27.836 1.00 13.89 ? 73 GLU A CA 1 5: ATOM 576 C C . GLU A 1 73 ? 11.083 29.318 26.301 1.00 13.70 ? 73 GLU A C 1 5: ATOM 577 O O . GLU A 1 73 ? 10.159 29.859 25.690 1.00 13.63 ? 73 GLU A O 1 5: ATOM 578 C CB . GLU A 1 73 ? 11.780 28.032 28.379 1.00 12.63 ? 73 GLU A CB 1 5: ATOM 579 C CG . GLU A 1 73 ? 11.145 26.706 27.986 1.00 10.55 ? 73 GLU A CG 1 5: ATOM 580 C CD . GLU A 1 73 ? 11.997 25.499 28.366 1.00 8.94 ? 73 GLU A CD 1 5: ATOM 581 O OE1 . GLU A 1 73 ? 13.191 25.650 28.642 1.00 12.29 ? 73 GLU A OE1 1 5: ATOM 582 O OE2 . GLU A 1 73 ? 11.485 24.374 28.363 1.00 10.37 ? 73 GLU A OE2 1 5: ATOM 583 N N . GLN A 1 74 ? 12.115 28.751 25.685 1.00 13.09 ? 74 GLN A N 1 5: ATOM 584 C CA . GLN A 1 74 ? 12.187 28.691 24.239 1.00 13.16 ? 74 GLN A CA 1 5: ATOM 585 C C . GLN A 1 74 ? 12.618 27.315 23.806 1.00 12.86 ? 74 GLN A C 1 5: ATOM 586 O O . GLN A 1 74 ? 13.290 26.596 24.552 1.00 13.17 ? 74 GLN A O 1 5: ATOM 587 C CB . GLN A 1 74 ? 13.218 29.685 23.706 1.00 15.91 ? 74 GLN A CB 1 5: ATOM 588 C CG . GLN A 1 74 ? 12.803 31.133 23.779 1.00 19.68 ? 74 GLN A CG 1 5: ATOM 589 C CD . GLN A 1 74 ? 13.827 32.066 23.159 1.00 21.00 ? 74 GLN A CD 1 5: ATOM 590 O OE1 . GLN A 1 74 ? 15.010 31.730 23.024 1.00 22.37 ? 74 GLN A OE1 1 5: ATOM 591 N NE2 . GLN A 1 74 ? 13.373 33.247 22.774 1.00 24.07 ? 74 GLN A NE2 1 5: ATOM 592 N N . THR A 1 75 ? 12.229 26.935 22.600 1.00 10.98 ? 75 THR A N 1 5: ATOM 593 C CA . THR A 1 75 ? 12.664 25.656 22.056 1.00 11.83 ? 75 THR A CA 1 5: ATOM 594 C C . THR A 1 75 ? 14.162 25.828 21.729 1.00 11.24 ? 75 THR A C 1 5: ATOM 595 O O . THR A 1 75 ? 14.681 26.951 21.764 1.00 9.95 ? 75 THR A O 1 5: ATOM 596 C CB . THR A 1 75 ? 11.895 25.325 20.757 1.00 11.93 ? 75 THR A CB 1 5: ATOM 597 O OG1 . THR A 1 75 ? 12.123 26.366 19.795 1.00 13.31 ? 75 THR A OG1 1 5: ATOM 598 C CG2 . THR A 1 75 ? 10.396 25.202 21.042 1.00 13.29 ? 75 THR A CG2 1 5: ATOM 599 N N . VAL A 1 76 ? 14.841 24.731 21.377 1.00 13.77 ? 76 VAL A N 1 5: ATOM 600 C CA . VAL A 1 76 ? 16.278 24.762 21.049 1.00 14.39 ? 76 VAL A CA 1 5: ATOM 601 C C . VAL A 1 76 ? 16.612 25.734 19.914 1.00 12.97 ? 76 VAL A C 1 5: ATOM 602 O O . VAL A 1 76 ? 17.639 26.407 19.956 1.00 13.75 ? 76 VAL A O 1 5: ATOM 603 C CB . VAL A 1 76 ? 16.827 23.351 20.680 1.00 15.44 ? 76 VAL A CB 1 5: ATOM 604 C CG1 . VAL A 1 76 ? 18.332 23.314 20.844 1.00 17.74 ? 76 VAL A CG1 1 5: ATOM 605 C CG2 . VAL A 1 76 ? 16.218 22.293 21.548 1.00 19.99 ? 76 VAL A CG2 1 5: ATOM 606 N N . ASP A 1 77 ? 15.730 25.824 18.921 1.00 13.67 ? 77 ASP A N 1 5: ATOM 607 C CA . ASP A 1 77 ? 15.933 26.727 17.789 1.00 14.47 ? 77 ASP A CA 1 5: ATOM 608 C C . ASP A 1 77 ? 15.486 28.172 18.061 1.00 15.23 ? 77 ASP A C 1 5: ATOM 609 O O . ASP A 1 77 ? 15.461 29.002 17.153 1.00 14.90 ? 77 ASP A O 1 5: ATOM 610 C CB . ASP A 1 77 ? 15.301 26.158 16.503 1.00 15.63 ? 77 ASP A CB 1 5: ATOM 611 C CG . ASP A 1 77 ? 13.790 26.007 16.585 1.00 15.92 ? 77 ASP A CG 1 5: ATOM 612 O OD1 . ASP A 1 77 ? 13.260 25.470 17.586 1.00 14.64 ? 77 ASP A OD1 1 5: ATOM 613 O OD2 . ASP A 1 77 ? 13.123 26.409 15.613 1.00 17.79 ? 77 ASP A OD2 1 5: ATOM 614 N N . GLY A 1 78 ? 15.095 28.445 19.312 1.00 15.17 ? 78 GLY A N 1 5: ATOM 615 C CA . GLY A 1 78 ? 14.709 29.790 19.726 1.00 15.90 ? 78 GLY A CA 1 5: ATOM 616 C C . GLY A 1 78 ? 13.268 30.281 19.701 1.00 16.89 ? 78 GLY A C 1 5: ATOM 617 O O . GLY A 1 78 ? 13.038 31.489 19.790 1.00 19.37 ? 78 GLY A O 1 5: ATOM 618 N N . ARG A 1 79 ? 12.292 29.389 19.620 1.00 16.76 ? 79 ARG A N 1 5: ATOM 619 C CA . ARG A 1 79 ? 10.896 29.822 19.587 1.00 18.08 ? 79 ARG A CA 1 5: ATOM 620 C C . ARG A 1 79 ? 10.229 29.768 20.961 1.00 16.55 ? 79 ARG A C 1 5: ATOM 621 O O . ARG A 1 79 ? 10.379 28.787 21.680 1.00 16.57 ? 79 ARG A O 1 5: ATOM 622 C CB . ARG A 1 79 ? 10.112 28.961 18.604 1.00 20.74 ? 79 ARG A CB 1 5: ATOM 623 C CG . ARG A 1 79 ? 10.667 28.997 17.194 1.00 25.89 ? 79 ARG A CG 1 5: ATOM 624 C CD . ARG A 1 79 ? 9.986 27.976 16.310 1.00 29.77 ? 79 ARG A CD 1 5: ATOM 625 N NE . ARG A 1 79 ? 10.144 26.626 16.842 1.00 34.52 ? 79 ARG A NE 1 5: ATOM 626 C CZ . ARG A 1 79 ? 10.128 25.516 16.109 1.00 35.90 ? 79 ARG A CZ 1 5: ATOM 627 N NH1 . ARG A 1 79 ? 9.971 25.580 14.789 1.00 37.70 ? 79 ARG A NH1 1 5: ATOM 628 N NH2 . ARG A 1 79 ? 10.266 24.337 16.702 1.00 35.58 ? 79 ARG A NH2 1 5: ATOM 629 N N . PRO A 1 80 ? 9.501 30.830 21.352 1.00 15.98 ? 80 PRO A N 1 5: ATOM 630 C CA . PRO A 1 80 ? 8.819 30.867 22.651 1.00 15.47 ? 80 PRO A CA 1 5: ATOM 631 C C . PRO A 1 80 ? 7.825 29.725 22.833 1.00 14.23 ? 80 PRO A C 1 5: ATOM 632 O O . PRO A 1 80 ? 7.058 29.393 21.926 1.00 14.56 ? 80 PRO A O 1 5: ATOM 633 C CB . PRO A 1 80 ? 8.100 32.220 22.628 1.00 15.48 ? 80 PRO A CB 1 5: ATOM 634 C CG . PRO A 1 80 ? 9.010 33.057 21.846 1.00 18.18 ? 80 PRO A CG 1 5: ATOM 635 C CD . PRO A 1 80 ? 9.418 32.145 20.696 1.00 17.08 ? 80 PRO A CD 1 5: ATOM 636 N N . CYS A 1 81 ? 7.817 29.148 24.028 1.00 13.52 ? 81 CYS A N 1 5: ATOM 637 C CA . CYS A 1 81 ? 6.914 28.055 24.331 1.00 12.41 ? 81 CYS A CA 1 5: ATOM 638 C C . CYS A 1 81 ? 6.548 28.054 25.811 1.00 12.52 ? 81 CYS A C 1 5: ATOM 639 O O . CYS A 1 81 ? 7.202 28.718 26.624 1.00 11.74 ? 81 CYS A O 1 5: ATOM 640 C CB . CYS A 1 81 ? 7.563 26.705 23.950 1.00 11.59 ? 81 CYS A CB 1 5: ATOM 641 S SG . CYS A 1 81 ? 9.063 26.255 24.894 1.00 12.86 ? 81 CYS A SG 1 5: ATOM 642 N N . LYS A 1 82 ? 5.448 27.379 26.121 1.00 13.86 ? 82 LYS A N 1 5: ATOM 643 C CA . LYS A 1 82 ? 4.988 27.197 27.492 1.00 14.38 ? 82 LYS A CA 1 5: ATOM 644 C C . LYS A 1 82 ? 5.436 25.779 27.839 1.00 13.51 ? 82 LYS A C 1 5: ATOM 645 O O . LYS A 1 82 ? 5.227 24.842 27.063 1.00 12.69 ? 82 LYS A O 1 5: ATOM 646 C CB . LYS A 1 82 ? 3.473 27.299 27.589 1.00 18.36 ? 82 LYS A CB 1 5: ATOM 647 C CG . LYS A 1 82 ? 2.940 28.716 27.584 1.00 26.02 ? 82 LYS A CG 1 5: ATOM 648 C CD . LYS A 1 82 ? 3.353 29.506 28.826 1.00 31.13 ? 82 LYS A CD 1 5: ATOM 649 C CE . LYS A 1 82 ? 2.686 30.894 28.832 1.00 35.39 ? 82 LYS A CE 1 5: ATOM 650 N NZ . LYS A 1 82 ? 2.868 31.652 30.120 1.00 37.63 ? 82 LYS A NZ 1 5: ATOM 651 N N . SER A 1 83 ? 6.110 25.638 28.974 1.00 11.15 ? 83 SER A N 1 5: ATOM 652 C CA . SER A 1 83 ? 6.624 24.352 29.397 1.00 10.10 ? 83 SER A CA 1 5: ATOM 653 C C . SER A 1 83 ? 6.083 23.931 30.752 1.00 11.16 ? 83 SER A C 1 5: ATOM 654 O O . SER A 1 83 ? 5.721 24.769 31.575 1.00 10.21 ? 83 SER A O 1 5: ATOM 655 C CB . SER A 1 83 ? 8.149 24.418 29.446 1.00 10.30 ? 83 SER A CB 1 5: ATOM 656 O OG . SER A 1 83 ? 8.686 24.518 28.132 1.00 11.50 ? 83 SER A OG 1 5: ATOM 657 N N . LEU A 1 84 ? 6.028 22.620 30.954 1.00 11.17 ? 84 LEU A N 1 5: ATOM 658 C CA . LEU A 1 84 ? 5.557 22.016 32.192 1.00 11.84 ? 84 LEU A CA 1 5: ATOM 659 C C . LEU A 1 84 ? 6.427 20.793 32.470 1.00 10.42 ? 84 LEU A C 1 5: ATOM 660 O O . LEU A 1 84 ? 6.444 19.846 31.684 1.00 11.20 ? 84 LEU A O 1 5: ATOM 661 C CB . LEU A 1 84 ? 4.091 21.576 32.067 1.00 13.44 ? 84 LEU A CB 1 5: ATOM 662 C CG . LEU A 1 84 ? 3.552 20.784 33.270 1.00 15.74 ? 84 LEU A CG 1 5: ATOM 663 C CD1 . LEU A 1 84 ? 3.515 21.683 34.484 1.00 16.96 ? 84 LEU A CD1 1 5: ATOM 664 C CD2 . LEU A 1 84 ? 2.178 20.231 32.982 1.00 18.76 ? 84 LEU A CD2 1 5: ATOM 665 N N . VAL A 1 85 ? 7.146 20.828 33.589 1.00 9.60 ? 85 VAL A N 1 5: ATOM 666 C CA . VAL A 1 85 ? 8.028 19.738 34.006 1.00 9.50 ? 85 VAL A CA 1 5: ATOM 667 C C . VAL A 1 85 ? 7.344 18.878 35.082 1.00 9.74 ? 85 VAL A C 1 5: ATOM 668 O O . VAL A 1 85 ? 6.680 19.404 35.985 1.00 9.28 ? 85 VAL A O 1 5: ATOM 669 C CB . VAL A 1 85 ? 9.384 20.291 34.598 1.00 8.89 ? 85 VAL A CB 1 5: ATOM 670 C CG1 . VAL A 1 85 ? 10.327 19.140 34.970 1.00 8.20 ? 85 VAL A CG1 1 5: ATOM 671 C CG2 . VAL A 1 85 ? 10.062 21.227 33.612 1.00 8.48 ? 85 VAL A CG2 1 5: ATOM 672 N N . LYS A 1 86 ? 7.504 17.563 34.971 1.00 9.96 ? 86 LYS A N 1 5: ATOM 673 C CA . LYS A 1 86 ? 6.946 16.621 35.945 1.00 11.92 ? 86 LYS A CA 1 5: ATOM 674 C C . LYS A 1 86 ? 8.003 15.558 36.247 1.00 11.88 ? 86 LYS A C 1 5: ATOM 675 O O . LYS A 1 86 ? 8.917 15.340 35.453 1.00 11.00 ? 86 LYS A O 1 5: ATOM 676 C CB . LYS A 1 86 ? 5.700 15.911 35.385 1.00 12.40 ? 86 LYS A CB 1 5: ATOM 677 C CG . LYS A 1 86 ? 4.538 16.819 35.058 1.00 16.01 ? 86 LYS A CG 1 5: ATOM 678 C CD . LYS A 1 86 ? 3.333 16.017 34.559 1.00 21.36 ? 86 LYS A CD 1 5: ATOM 679 C CE . LYS A 1 86 ? 2.140 16.939 34.345 1.00 23.23 ? 86 LYS A CE 1 5: ATOM 680 N NZ . LYS A 1 86 ? 0.919 16.212 33.929 1.00 28.41 ? 86 LYS A NZ 1 5: ATOM 681 N N . TRP A 1 87 ? 7.868 14.889 37.386 1.00 10.75 ? 87 TRP A N 1 5: ATOM 682 C CA . TRP A 1 87 ? 8.775 13.811 37.738 1.00 9.53 ? 87 TRP A CA 1 5: ATOM 683 C C . TRP A 1 87 ? 8.238 12.559 37.052 1.00 9.89 ? 87 TRP A C 1 5: ATOM 684 O O . TRP A 1 87 ? 7.144 12.107 37.370 1.00 11.80 ? 87 TRP A O 1 5: ATOM 685 C CB . TRP A 1 87 ? 8.791 13.569 39.268 1.00 8.76 ? 87 TRP A CB 1 5: ATOM 686 C CG . TRP A 1 87 ? 9.494 14.641 40.062 1.00 8.86 ? 87 TRP A CG 1 5: ATOM 687 C CD1 . TRP A 1 87 ? 8.923 15.525 40.939 1.00 8.80 ? 87 TRP A CD1 1 5: ATOM 688 C CD2 . TRP A 1 87 ? 10.889 14.990 39.992 1.00 9.42 ? 87 TRP A CD2 1 5: ATOM 689 N NE1 . TRP A 1 87 ? 9.872 16.410 41.400 1.00 8.01 ? 87 TRP A NE1 1 5: ATOM 690 C CE2 . TRP A 1 87 ? 11.086 16.103 40.835 1.00 10.85 ? 87 TRP A CE2 1 5: ATOM 691 C CE3 . TRP A 1 87 ? 11.985 14.475 39.283 1.00 9.60 ? 87 TRP A CE3 1 5: ATOM 692 C CZ2 . TRP A 1 87 ? 12.340 16.716 40.994 1.00 11.45 ? 87 TRP A CZ2 1 5: ATOM 693 C CZ3 . TRP A 1 87 ? 13.230 15.084 39.438 1.00 10.72 ? 87 TRP A CZ3 1 5: ATOM 694 C CH2 . TRP A 1 87 ? 13.395 16.192 40.289 1.00 11.78 ? 87 TRP A CH2 1 5: ATOM 695 N N . GLU A 1 88 ? 8.954 12.040 36.064 1.00 9.93 ? 88 GLU A N 1 5: ATOM 696 C CA . GLU A 1 88 ? 8.526 10.807 35.416 1.00 11.30 ? 88 GLU A CA 1 5: ATOM 697 C C . GLU A 1 88 ? 8.826 9.726 36.448 1.00 11.75 ? 88 GLU A C 1 5: ATOM 698 O O . GLU A 1 88 ? 8.068 8.784 36.623 1.00 12.78 ? 88 GLU A O 1 5: ATOM 699 C CB . GLU A 1 88 ? 9.337 10.541 34.156 1.00 13.50 ? 88 GLU A CB 1 5: ATOM 700 C CG . GLU A 1 88 ? 8.917 9.261 33.454 1.00 18.67 ? 88 GLU A CG 1 5: ATOM 701 C CD . GLU A 1 88 ? 9.756 8.958 32.226 1.00 23.49 ? 88 GLU A CD 1 5: ATOM 702 O OE1 . GLU A 1 88 ? 9.581 9.650 31.205 1.00 26.53 ? 88 GLU A OE1 1 5: ATOM 703 O OE2 . GLU A 1 88 ? 10.587 8.025 32.276 1.00 26.54 ? 88 GLU A OE2 1 5: ATOM 704 N N . SER A 1 89 ? 9.972 9.870 37.103 1.00 11.49 ? 89 SER A N 1 5: ATOM 705 C CA . SER A 1 89 ? 10.402 8.954 38.158 1.00 11.10 ? 89 SER A CA 1 5: ATOM 706 C C . SER A 1 89 ? 11.206 9.776 39.163 1.00 11.14 ? 89 SER A C 1 5: ATOM 707 O O . SER A 1 89 ? 11.397 10.983 38.979 1.00 9.92 ? 89 SER A O 1 5: ATOM 708 C CB . SER A 1 89 ? 11.221 7.778 37.604 1.00 12.43 ? 89 SER A CB 1 5: ATOM 709 O OG . SER A 1 89 ? 12.396 8.215 36.947 1.00 14.39 ? 89 SER A OG 1 5: ATOM 710 N N . GLU A 1 90 ? 11.674 9.130 40.227 1.00 10.17 ? 90 GLU A N 1 5: ATOM 711 C CA . GLU A 1 90 ? 12.433 9.826 41.254 1.00 10.83 ? 90 GLU A CA 1 5: ATOM 712 C C . GLU A 1 90 ? 13.657 10.629 40.772 1.00 9.86 ? 90 GLU A C 1 5: ATOM 713 O O . GLU A 1 90 ? 13.932 11.715 41.289 1.00 10.30 ? 90 GLU A O 1 5: ATOM 714 C CB . GLU A 1 90 ? 12.858 8.846 42.348 1.00 11.92 ? 90 GLU A CB 1 5: ATOM 715 C CG . GLU A 1 90 ? 13.536 9.572 43.487 1.00 16.53 ? 90 GLU A CG 1 5: ATOM 716 C CD . GLU A 1 90 ? 13.912 8.671 44.644 1.00 19.80 ? 90 GLU A CD 1 5: ATOM 717 O OE1 . GLU A 1 90 ? 14.122 7.464 44.426 1.00 21.18 ? 90 GLU A OE1 1 5: ATOM 718 O OE2 . GLU A 1 90 ? 14.012 9.187 45.774 1.00 22.91 ? 90 GLU A OE2 1 5: ATOM 719 N N . ASN A 1 91 ? 14.376 10.102 39.783 1.00 8.79 ? 91 ASN A N 1 5: ATOM 720 C CA . ASN A 1 91 ? 15.578 10.767 39.274 1.00 10.50 ? 91 ASN A CA 1 5: ATOM 721 C C . ASN A 1 91 ? 15.455 11.289 37.855 1.00 9.69 ? 91 ASN A C 1 5: ATOM 722 O O . ASN A 1 91 ? 16.467 11.627 37.246 1.00 7.10 ? 91 ASN A O 1 5: ATOM 723 C CB . ASN A 1 91 ? 16.760 9.798 39.305 1.00 14.33 ? 91 ASN A CB 1 5: ATOM 724 C CG . ASN A 1 91 ? 17.064 9.307 40.693 1.00 17.71 ? 91 ASN A CG 1 5: ATOM 725 O OD1 . ASN A 1 91 ? 17.445 10.087 41.560 1.00 20.87 ? 91 ASN A OD1 1 5: ATOM 726 N ND2 . ASN A 1 91 ? 16.855 8.016 40.928 1.00 19.39 ? 91 ASN A ND2 1 5: ATOM 727 N N . LYS A 1 92 ? 14.230 11.387 37.352 1.00 8.60 ? 92 LYS A N 1 5: ATOM 728 C CA . LYS A 1 92 ? 14.016 11.835 35.981 1.00 8.88 ? 92 LYS A CA 1 5: ATOM 729 C C . LYS A 1 92 ? 12.861 12.812 35.807 1.00 8.61 ? 92 LYS A C 1 5: ATOM 730 O O . LYS A 1 92 ? 11.721 12.511 36.168 1.00 8.95 ? 92 LYS A O 1 5: ATOM 731 C CB . LYS A 1 92 ? 13.781 10.626 35.078 1.00 9.10 ? 92 LYS A CB 1 5: ATOM 732 C CG . LYS A 1 92 ? 13.566 10.996 33.618 1.00 11.95 ? 92 LYS A CG 1 5: ATOM 733 C CD . LYS A 1 92 ? 13.467 9.762 32.759 1.00 14.04 ? 92 LYS A CD 1 5: ATOM 734 C CE . LYS A 1 92 ? 13.333 10.124 31.299 1.00 16.33 ? 92 LYS A CE 1 5: ATOM 735 N NZ . LYS A 1 92 ? 13.129 8.884 30.506 1.00 17.37 ? 92 LYS A NZ 1 5: ATOM 736 N N . MET A 1 93 ? 13.172 13.988 35.268 1.00 7.58 ? 93 MET A N 1 5: ATOM 737 C CA . MET A 1 93 ? 12.159 14.985 34.995 1.00 8.21 ? 93 MET A CA 1 5: ATOM 738 C C . MET A 1 93 ? 11.915 15.038 33.496 1.00 9.18 ? 93 MET A C 1 5: ATOM 739 O O . MET A 1 93 ? 12.833 14.838 32.690 1.00 7.74 ? 93 MET A O 1 5: ATOM 740 C CB . MET A 1 93 ? 12.565 16.359 35.523 1.00 9.68 ? 93 MET A CB 1 5: ATOM 741 C CG . MET A 1 93 ? 13.826 16.925 34.937 1.00 13.16 ? 93 MET A CG 1 5: ATOM 742 S SD . MET A 1 93 ? 14.238 18.543 35.628 1.00 17.49 ? 93 MET A SD 1 5: ATOM 743 C CE . MET A 1 93 ? 15.009 18.106 37.076 1.00 18.53 ? 93 MET A CE 1 5: ATOM 744 N N . VAL A 1 94 ? 10.658 15.239 33.128 1.00 9.48 ? 94 VAL A N 1 5: ATOM 745 C CA . VAL A 1 94 ? 10.266 15.334 31.726 1.00 9.55 ? 94 VAL A CA 1 5: ATOM 746 C C . VAL A 1 94 ? 9.516 16.639 31.528 1.00 10.10 ? 94 VAL A C 1 5: ATOM 747 O O . VAL A 1 94 ? 8.683 17.024 32.364 1.00 9.47 ? 94 VAL A O 1 5: ATOM 748 C CB . VAL A 1 94 ? 9.371 14.164 31.315 1.00 11.05 ? 94 VAL A CB 1 5: ATOM 749 C CG1 . VAL A 1 94 ? 8.878 14.354 29.878 1.00 12.88 ? 94 VAL A CG1 1 5: ATOM 750 C CG2 . VAL A 1 94 ? 10.147 12.866 31.420 1.00 14.00 ? 94 VAL A CG2 1 5: ATOM 751 N N . CYS A 1 95 ? 9.802 17.312 30.413 1.00 9.49 ? 95 CYS A N 1 5: ATOM 752 C CA . CYS A 1 95 ? 9.169 18.582 30.094 1.00 8.82 ? 95 CYS A CA 1 5: ATOM 753 C C . CYS A 1 95 ? 8.431 18.559 28.758 1.00 11.70 ? 95 CYS A C 1 5: ATOM 754 O O . CYS A 1 95 ? 9.014 18.215 27.723 1.00 12.29 ? 95 CYS A O 1 5: ATOM 755 C CB . CYS A 1 95 ? 10.229 19.679 30.059 1.00 8.79 ? 95 CYS A CB 1 5: ATOM 756 S SG . CYS A 1 95 ? 9.620 21.322 29.690 1.00 10.97 ? 95 CYS A SG 1 5: ATOM 757 N N . GLU A 1 96 ? 7.149 18.902 28.791 1.00 10.87 ? 96 GLU A N 1 5: ATOM 758 C CA . GLU A 1 96 ? 6.342 18.962 27.587 1.00 14.78 ? 96 GLU A CA 1 5: ATOM 759 C C . GLU A 1 96 ? 6.267 20.439 27.182 1.00 13.83 ? 96 GLU A C 1 5: ATOM 760 O O . GLU A 1 96 ? 6.044 21.311 28.030 1.00 12.79 ? 96 GLU A O 1 5: ATOM 761 C CB . GLU A 1 96 ? 4.957 18.397 27.885 1.00 20.21 ? 96 GLU A CB 1 5: ATOM 762 C CG . GLU A 1 96 ? 3.981 18.432 26.726 1.00 32.46 ? 96 GLU A CG 1 5: ATOM 763 C CD . GLU A 1 96 ? 2.646 17.765 27.065 1.00 38.97 ? 96 GLU A CD 1 5: ATOM 764 O OE1 . GLU A 1 96 ? 2.053 18.108 28.128 1.00 42.61 ? 96 GLU A OE1 1 5: ATOM 765 O OE2 . GLU A 1 96 ? 2.201 16.892 26.271 1.00 42.17 ? 96 GLU A OE2 1 5: ATOM 766 N N . GLN A 1 97 ? 6.513 20.725 25.903 1.00 13.39 ? 97 GLN A N 1 5: ATOM 767 C CA . GLN A 1 97 ? 6.489 22.100 25.402 1.00 13.55 ? 97 GLN A CA 1 5: ATOM 768 C C . GLN A 1 97 ? 5.357 22.334 24.400 1.00 15.88 ? 97 GLN A C 1 5: ATOM 769 O O . GLN A 1 97 ? 5.013 21.455 23.591 1.00 16.25 ? 97 GLN A O 1 5: ATOM 770 C CB . GLN A 1 97 ? 7.823 22.465 24.747 1.00 12.20 ? 97 GLN A CB 1 5: ATOM 771 C CG . GLN A 1 97 ? 9.033 22.324 25.650 1.00 12.55 ? 97 GLN A CG 1 5: ATOM 772 C CD . GLN A 1 97 ? 10.321 22.613 24.927 1.00 14.20 ? 97 GLN A CD 1 5: ATOM 773 O OE1 . GLN A 1 97 ? 10.478 22.288 23.749 1.00 12.94 ? 97 GLN A OE1 1 5: ATOM 774 N NE2 . GLN A 1 97 ? 11.260 23.235 25.627 1.00 14.75 ? 97 GLN A NE2 1 5: ATOM 775 N N . LYS A 1 98 ? 4.801 23.541 24.450 1.00 17.30 ? 98 LYS A N 1 5: ATOM 776 C CA . LYS A 1 98 ? 3.696 23.952 23.582 1.00 19.78 ? 98 LYS A CA 1 5: ATOM 777 C C . LYS A 1 98 ? 3.990 25.340 23.019 1.00 18.56 ? 98 LYS A C 1 5: ATOM 778 O O . LYS A 1 98 ? 4.162 26.293 23.771 1.00 17.70 ? 98 LYS A O 1 5: ATOM 779 C CB . LYS A 1 98 ? 2.389 23.953 24.389 1.00 23.30 ? 98 LYS A CB 1 5: ATOM 780 C CG . LYS A 1 98 ? 1.294 24.857 23.867 1.00 30.94 ? 98 LYS A CG 1 5: ATOM 781 C CD . LYS A 1 98 ? 0.210 25.047 24.934 1.00 37.10 ? 98 LYS A CD 1 5: ATOM 782 C CE . LYS A 1 98 ? -0.849 26.072 24.520 1.00 39.73 ? 98 LYS A CE 1 5: ATOM 783 N NZ . LYS A 1 98 ? -0.326 27.476 24.541 1.00 42.46 ? 98 LYS A NZ 1 5: ATOM 784 N N . LEU A 1 99 ? 4.073 25.445 21.696 1.00 19.35 ? 99 LEU A N 1 5: ATOM 785 C CA . LEU A 1 99 ? 4.357 26.721 21.041 1.00 21.32 ? 99 LEU A CA 1 5: ATOM 786 C C . LEU A 1 99 ? 3.307 27.770 21.351 1.00 22.86 ? 99 LEU A C 1 5: ATOM 787 O O . LEU A 1 99 ? 2.108 27.496 21.261 1.00 23.41 ? 99 LEU A O 1 5: ATOM 788 C CB . LEU A 1 99 ? 4.466 26.542 19.526 1.00 22.09 ? 99 LEU A CB 1 5: ATOM 789 C CG . LEU A 1 99 ? 5.692 25.792 18.997 1.00 22.72 ? 99 LEU A CG 1 5: ATOM 790 C CD1 . LEU A 1 99 ? 5.585 25.639 17.490 1.00 23.04 ? 99 LEU A CD1 1 5: ATOM 791 C CD2 . LEU A 1 99 ? 6.951 26.548 19.372 1.00 23.61 ? 99 LEU A CD2 1 5: ATOM 792 N N . LEU A 1 100 ? 3.767 28.962 21.722 1.00 24.11 ? 100 LEU A N 1 5: ATOM 793 C CA . LEU A 1 100 ? 2.879 30.070 22.051 1.00 27.59 ? 100 LEU A CA 1 5: ATOM 794 C C . LEU A 1 100 ? 2.130 30.545 20.815 1.00 30.94 ? 100 LEU A C 1 5: ATOM 795 O O . LEU A 1 100 ? 0.951 30.908 20.877 1.00 31.34 ? 100 LEU A O 1 5: ATOM 796 C CB . LEU A 1 100 ? 3.680 31.227 22.640 1.00 25.50 ? 100 LEU A CB 1 5: ATOM 797 C CG . LEU A 1 100 ? 4.254 30.947 24.020 1.00 24.80 ? 100 LEU A CG 1 5: ATOM 798 C CD1 . LEU A 1 100 ? 4.960 32.171 24.542 1.00 26.59 ? 100 LEU A CD1 1 5: ATOM 799 C CD2 . LEU A 1 100 ? 3.141 30.554 24.935 1.00 24.80 ? 100 LEU A CD2 1 5: ATOM 800 N N . LYS A 1 101 ? 2.835 30.531 19.689 1.00 34.60 ? 101 LYS A N 1 5: ATOM 801 C CA . LYS A 1 101 ? 2.282 30.961 18.413 1.00 37.81 ? 101 LYS A CA 1 5: ATOM 802 C C . LYS A 1 101 ? 2.847 30.088 17.292 1.00 37.39 ? 101 LYS A C 1 5: ATOM 803 O O . LYS A 1 101 ? 4.019 29.687 17.319 1.00 37.22 ? 101 LYS A O 1 5: ATOM 804 C CB . LYS A 1 101 ? 2.653 32.429 18.147 1.00 40.57 ? 101 LYS A CB 1 5: ATOM 805 C CG . LYS A 1 101 ? 2.182 33.426 19.212 1.00 45.13 ? 101 LYS A CG 1 5: ATOM 806 C CD . LYS A 1 101 ? 2.955 34.741 19.125 1.00 48.57 ? 101 LYS A CD 1 5: ATOM 807 C CE . LYS A 1 101 ? 4.479 34.527 19.248 1.00 51.31 ? 101 LYS A CE 1 5: ATOM 808 N NZ . LYS A 1 101 ? 4.917 33.952 20.559 1.00 51.14 ? 101 LYS A NZ 1 5: ATOM 809 N N . GLY A 1 102 ? 1.997 29.786 16.318 1.00 37.21 ? 102 GLY A N 1 5: ATOM 810 C CA . GLY A 1 102 ? 2.423 28.993 15.184 1.00 36.82 ? 102 GLY A CA 1 5: ATOM 811 C C . GLY A 1 102 ? 2.333 27.494 15.344 1.00 36.36 ? 102 GLY A C 1 5: ATOM 812 O O . GLY A 1 102 ? 1.690 26.977 16.265 1.00 35.74 ? 102 GLY A O 1 5: ATOM 813 N N . GLU A 1 103 ? 2.954 26.803 14.395 1.00 35.74 ? 103 GLU A N 1 5: ATOM 814 C CA . GLU A 1 103 ? 2.988 25.348 14.377 1.00 35.50 ? 103 GLU A CA 1 5: ATOM 815 C C . GLU A 1 103 ? 4.418 24.880 14.140 1.00 31.92 ? 103 GLU A C 1 5: ATOM 816 O O . GLU A 1 103 ? 5.281 25.654 13.723 1.00 31.61 ? 103 GLU A O 1 5: ATOM 817 C CB . GLU A 1 103 ? 2.077 24.784 13.274 1.00 39.37 ? 103 GLU A CB 1 5: ATOM 818 C CG . GLU A 1 103 ? 0.652 24.422 13.712 1.00 45.52 ? 103 GLU A CG 1 5: ATOM 819 C CD . GLU A 1 103 ? -0.383 25.503 13.395 1.00 50.23 ? 103 GLU A CD 1 5: ATOM 820 O OE1 . GLU A 1 103 ? -0.130 26.346 12.499 1.00 53.12 ? 103 GLU A OE1 1 5: ATOM 821 O OE2 . GLU A 1 103 ? -1.464 25.500 14.036 1.00 52.16 ? 103 GLU A OE2 1 5: ATOM 822 N N . GLY A 1 104 ? 4.653 23.604 14.414 1.00 28.97 ? 104 GLY A N 1 5: ATOM 823 C CA . GLY A 1 104 ? 5.967 23.024 14.231 1.00 25.41 ? 104 GLY A CA 1 5: ATOM 824 C C . GLY A 1 104 ? 6.012 21.648 14.863 1.00 22.09 ? 104 GLY A C 1 5: ATOM 825 O O . GLY A 1 104 ? 4.987 21.160 15.347 1.00 21.89 ? 104 GLY A O 1 5: ATOM 826 N N . PRO A 1 105 ? 7.176 20.976 14.832 1.00 19.50 ? 105 PRO A N 1 5: ATOM 827 C CA . PRO A 1 105 ? 7.338 19.640 15.418 1.00 17.92 ? 105 PRO A CA 1 5: ATOM 828 C C . PRO A 1 105 ? 7.020 19.664 16.914 1.00 15.61 ? 105 PRO A C 1 5: ATOM 829 O O . PRO A 1 105 ? 7.170 20.696 17.567 1.00 14.42 ? 105 PRO A O 1 5: ATOM 830 C CB . PRO A 1 105 ? 8.828 19.348 15.202 1.00 18.86 ? 105 PRO A CB 1 5: ATOM 831 C CG . PRO A 1 105 ? 9.188 20.164 14.005 1.00 18.76 ? 105 PRO A CG 1 5: ATOM 832 C CD . PRO A 1 105 ? 8.423 21.440 14.199 1.00 18.40 ? 105 PRO A CD 1 5: ATOM 833 N N . LYS A 1 106 ? 6.552 18.541 17.444 1.00 16.02 ? 106 LYS A N 1 5: ATOM 834 C CA . LYS A 1 106 ? 6.255 18.453 18.868 1.00 16.93 ? 106 LYS A CA 1 5: ATOM 835 C C . LYS A 1 106 ? 7.609 18.305 19.554 1.00 15.49 ? 106 LYS A C 1 5: ATOM 836 O O . LYS A 1 106 ? 8.397 17.437 19.183 1.00 14.76 ? 106 LYS A O 1 5: ATOM 837 C CB . LYS A 1 106 ? 5.387 17.229 19.174 1.00 20.98 ? 106 LYS A CB 1 5: ATOM 838 C CG . LYS A 1 106 ? 5.015 17.097 20.662 1.00 27.98 ? 106 LYS A CG 1 5: ATOM 839 C CD . LYS A 1 106 ? 4.463 18.433 21.229 1.00 33.23 ? 106 LYS A CD 1 5: ATOM 840 C CE . LYS A 1 106 ? 4.250 18.417 22.764 1.00 35.21 ? 106 LYS A CE 1 5: ATOM 841 N NZ . LYS A 1 106 ? 5.519 18.251 23.566 1.00 33.75 ? 106 LYS A NZ 1 5: ATOM 842 N N . THR A 1 107 ? 7.907 19.167 20.515 1.00 13.91 ? 107 THR A N 1 5: ATOM 843 C CA . THR A 1 107 ? 9.203 19.086 21.190 1.00 12.14 ? 107 THR A CA 1 5: ATOM 844 C C . THR A 1 107 ? 9.083 18.819 22.681 1.00 11.66 ? 107 THR A C 1 5: ATOM 845 O O . THR A 1 107 ? 8.061 19.120 23.295 1.00 10.59 ? 107 THR A O 1 5: ATOM 846 C CB . THR A 1 107 ? 10.012 20.382 21.016 1.00 12.37 ? 107 THR A CB 1 5: ATOM 847 O OG1 . THR A 1 107 ? 9.263 21.480 21.547 1.00 12.36 ? 107 THR A OG1 1 5: ATOM 848 C CG2 . THR A 1 107 ? 10.327 20.643 19.544 1.00 12.62 ? 107 THR A CG2 1 5: ATOM 849 N N . SER A 1 108 ? 10.140 18.249 23.250 1.00 10.16 ? 108 SER A N 1 5: ATOM 850 C CA . SER A 1 108 ? 10.192 17.975 24.681 1.00 9.98 ? 108 SER A CA 1 5: ATOM 851 C C . SER A 1 108 ? 11.649 17.774 25.081 1.00 9.90 ? 108 SER A C 1 5: ATOM 852 O O . SER A 1 108 ? 12.549 17.774 24.227 1.00 8.48 ? 108 SER A O 1 5: ATOM 853 C CB . SER A 1 108 ? 9.370 16.729 25.024 1.00 9.84 ? 108 SER A CB 1 5: ATOM 854 O OG . SER A 1 108 ? 9.844 15.601 24.313 1.00 13.87 ? 108 SER A OG 1 5: ATOM 855 N N . TRP A 1 109 ? 11.890 17.708 26.386 1.00 7.96 ? 109 TRP A N 1 5: ATOM 856 C CA . TRP A 1 109 ? 13.233 17.446 26.894 1.00 7.85 ? 109 TRP A CA 1 5: ATOM 857 C C . TRP A 1 109 ? 13.109 16.693 28.209 1.00 7.56 ? 109 TRP A C 1 5: ATOM 858 O O . TRP A 1 109 ? 12.053 16.728 28.837 1.00 8.14 ? 109 TRP A O 1 5: ATOM 859 C CB . TRP A 1 109 ? 14.094 18.722 27.051 1.00 8.25 ? 109 TRP A CB 1 5: ATOM 860 C CG . TRP A 1 109 ? 13.627 19.829 28.007 1.00 8.07 ? 109 TRP A CG 1 5: ATOM 861 C CD1 . TRP A 1 109 ? 13.120 21.046 27.648 1.00 9.28 ? 109 TRP A CD1 1 5: ATOM 862 C CD2 . TRP A 1 109 ? 13.745 19.865 29.450 1.00 9.31 ? 109 TRP A CD2 1 5: ATOM 863 N NE1 . TRP A 1 109 ? 12.929 21.836 28.760 1.00 9.69 ? 109 TRP A NE1 1 5: ATOM 864 C CE2 . TRP A 1 109 ? 13.306 21.136 29.878 1.00 9.04 ? 109 TRP A CE2 1 5: ATOM 865 C CE3 . TRP A 1 109 ? 14.186 18.939 30.416 1.00 9.92 ? 109 TRP A CE3 1 5: ATOM 866 C CZ2 . TRP A 1 109 ? 13.286 21.515 31.228 1.00 9.72 ? 109 TRP A CZ2 1 5: ATOM 867 C CZ3 . TRP A 1 109 ? 14.163 19.316 31.758 1.00 10.25 ? 109 TRP A CZ3 1 5: ATOM 868 C CH2 . TRP A 1 109 ? 13.717 20.593 32.149 1.00 10.11 ? 109 TRP A CH2 1 5: ATOM 869 N N . THR A 1 110 ? 14.136 15.924 28.549 1.00 7.39 ? 110 THR A N 1 5: ATOM 870 C CA . THR A 1 110 ? 14.168 15.176 29.808 1.00 6.23 ? 110 THR A CA 1 5: ATOM 871 C C . THR A 1 110 ? 15.577 15.334 30.395 1.00 7.40 ? 110 THR A C 1 5: ATOM 872 O O . THR A 1 110 ? 16.558 15.563 29.652 1.00 6.43 ? 110 THR A O 1 5: ATOM 873 C CB . THR A 1 110 ? 13.887 13.633 29.626 1.00 7.17 ? 110 THR A CB 1 5: ATOM 874 O OG1 . THR A 1 110 ? 15.000 13.002 28.973 1.00 7.49 ? 110 THR A OG1 1 5: ATOM 875 C CG2 . THR A 1 110 ? 12.616 13.377 28.803 1.00 6.64 ? 110 THR A CG2 1 5: ATOM 876 N N . ARG A 1 111 ? 15.669 15.293 31.727 1.00 6.72 ? 111 ARG A N 1 5: ATOM 877 C CA . ARG A 1 111 ? 16.966 15.356 32.425 1.00 6.27 ? 111 ARG A CA 1 5: ATOM 878 C C . ARG A 1 111 ? 16.924 14.287 33.483 1.00 7.89 ? 111 ARG A C 1 5: ATOM 879 O O . ARG A 1 111 ? 15.928 14.156 34.193 1.00 8.35 ? 111 ARG A O 1 5: ATOM 880 C CB . ARG A 1 111 ? 17.240 16.722 33.068 1.00 6.20 ? 111 ARG A CB 1 5: ATOM 881 C CG . ARG A 1 111 ? 17.703 17.765 32.060 1.00 7.38 ? 111 ARG A CG 1 5: ATOM 882 C CD . ARG A 1 111 ? 18.100 19.072 32.727 1.00 8.70 ? 111 ARG A CD 1 5: ATOM 883 N NE . ARG A 1 111 ? 18.783 19.965 31.784 1.00 9.83 ? 111 ARG A NE 1 5: ATOM 884 C CZ . ARG A 1 111 ? 18.158 20.804 30.963 1.00 10.23 ? 111 ARG A CZ 1 5: ATOM 885 N NH1 . ARG A 1 111 ? 16.840 20.869 30.966 1.00 10.89 ? 111 ARG A NH1 1 5: ATOM 886 N NH2 . ARG A 1 111 ? 18.847 21.590 30.144 1.00 11.56 ? 111 ARG A NH2 1 5: ATOM 887 N N . GLU A 1 112 ? 17.957 13.464 33.534 1.00 7.64 ? 112 GLU A N 1 5: ATOM 888 C CA . GLU A 1 112 ? 17.977 12.402 34.527 1.00 10.31 ? 112 GLU A CA 1 5: ATOM 889 C C . GLU A 1 112 ? 19.356 12.142 35.113 1.00 9.93 ? 112 GLU A C 1 5: ATOM 890 O O . GLU A 1 112 ? 20.367 12.273 34.425 1.00 7.92 ? 112 GLU A O 1 5: ATOM 891 C CB . GLU A 1 112 ? 17.401 11.118 33.940 1.00 14.05 ? 112 GLU A CB 1 5: ATOM 892 C CG . GLU A 1 112 ? 18.213 10.489 32.836 1.00 20.37 ? 112 GLU A CG 1 5: ATOM 893 C CD . GLU A 1 112 ? 17.484 9.325 32.177 1.00 25.09 ? 112 GLU A CD 1 5: ATOM 894 O OE1 . GLU A 1 112 ? 17.223 8.308 32.883 1.00 22.36 ? 112 GLU A OE1 1 5: ATOM 895 O OE2 . GLU A 1 112 ? 17.175 9.443 30.955 1.00 25.10 ? 112 GLU A OE2 1 5: ATOM 896 N N . LEU A 1 113 ? 19.387 11.816 36.401 1.00 8.96 ? 113 LEU A N 1 5: ATOM 897 C CA . LEU A 1 113 ? 20.634 11.503 37.091 1.00 12.04 ? 113 LEU A CA 1 5: ATOM 898 C C . LEU A 1 113 ? 20.789 9.991 37.081 1.00 12.06 ? 113 LEU A C 1 5: ATOM 899 O O . LEU A 1 113 ? 19.906 9.270 37.559 1.00 12.08 ? 113 LEU A O 1 5: ATOM 900 C CB . LEU A 1 113 ? 20.575 11.983 38.532 1.00 14.38 ? 113 LEU A CB 1 5: ATOM 901 C CG . LEU A 1 113 ? 20.768 13.465 38.799 1.00 17.46 ? 113 LEU A CG 1 5: ATOM 902 C CD1 . LEU A 1 113 ? 20.709 13.656 40.298 1.00 19.61 ? 113 LEU A CD1 1 5: ATOM 903 C CD2 . LEU A 1 113 ? 22.128 13.945 38.266 1.00 18.46 ? 113 LEU A CD2 1 5: ATOM 904 N N . THR A 1 114 ? 21.895 9.502 36.535 1.00 11.06 ? 114 THR A N 1 5: ATOM 905 C CA . THR A 1 114 ? 22.110 8.062 36.452 1.00 11.74 ? 114 THR A CA 1 5: ATOM 906 C C . THR A 1 114 ? 22.816 7.522 37.686 1.00 11.41 ? 114 THR A C 1 5: ATOM 907 O O . THR A 1 114 ? 23.327 8.282 38.501 1.00 11.47 ? 114 THR A O 1 5: ATOM 908 C CB . THR A 1 114 ? 22.894 7.700 35.188 1.00 12.89 ? 114 THR A CB 1 5: ATOM 909 O OG1 . THR A 1 114 ? 24.109 8.451 35.164 1.00 15.50 ? 114 THR A OG1 1 5: ATOM 910 C CG2 . THR A 1 114 ? 22.075 8.037 33.951 1.00 14.75 ? 114 THR A CG2 1 5: ATOM 911 N N . ASN A 1 115 ? 22.834 6.202 37.808 1.00 13.23 ? 115 ASN A N 1 5: ATOM 912 C CA . ASN A 1 115 ? 23.441 5.538 38.951 1.00 16.19 ? 115 ASN A CA 1 5: ATOM 913 C C . ASN A 1 115 ? 24.930 5.761 39.139 1.00 14.24 ? 115 ASN A C 1 5: ATOM 914 O O . ASN A 1 115 ? 25.432 5.626 40.256 1.00 14.74 ? 115 ASN A O 1 5: ATOM 915 C CB . ASN A 1 115 ? 23.123 4.047 38.918 1.00 21.89 ? 115 ASN A CB 1 5: ATOM 916 C CG . ASN A 1 115 ? 21.703 3.754 39.357 1.00 29.77 ? 115 ASN A CG 1 5: ATOM 917 O OD1 . ASN A 1 115 ? 20.955 3.046 38.669 1.00 34.83 ? 115 ASN A OD1 1 5: ATOM 918 N ND2 . ASN A 1 115 ? 21.313 4.310 40.516 1.00 32.90 ? 115 ASN A ND2 1 5: ATOM 919 N N . ASP A 1 116 ? 25.626 6.095 38.055 1.00 12.05 ? 116 ASP A N 1 5: ATOM 920 C CA . ASP A 1 116 ? 27.061 6.364 38.094 1.00 11.99 ? 116 ASP A CA 1 5: ATOM 921 C C . ASP A 1 116 ? 27.424 7.821 38.397 1.00 11.45 ? 116 ASP A C 1 5: ATOM 922 O O . ASP A 1 116 ? 28.592 8.184 38.393 1.00 12.23 ? 116 ASP A O 1 5: ATOM 923 C CB . ASP A 1 116 ? 27.764 5.875 36.806 1.00 13.89 ? 116 ASP A CB 1 5: ATOM 924 C CG . ASP A 1 116 ? 27.177 6.474 35.512 1.00 16.58 ? 116 ASP A CG 1 5: ATOM 925 O OD1 . ASP A 1 116 ? 26.263 7.303 35.569 1.00 19.66 ? 116 ASP A OD1 1 5: ATOM 926 O OD2 . ASP A 1 116 ? 27.651 6.113 34.422 1.00 20.14 ? 116 ASP A OD2 1 5: ATOM 927 N N . GLY A 1 117 ? 26.420 8.647 38.675 1.00 10.58 ? 117 GLY A N 1 5: ATOM 928 C CA . GLY A 1 117 ? 26.669 10.042 38.997 1.00 9.83 ? 117 GLY A CA 1 5: ATOM 929 C C . GLY A 1 117 ? 26.652 11.019 37.831 1.00 9.97 ? 117 GLY A C 1 5: ATOM 930 O O . GLY A 1 117 ? 26.945 12.192 38.019 1.00 10.45 ? 117 GLY A O 1 5: ATOM 931 N N . GLU A 1 118 ? 26.289 10.550 36.638 1.00 9.43 ? 118 GLU A N 1 5: ATOM 932 C CA . GLU A 1 118 ? 26.242 11.413 35.458 1.00 7.79 ? 118 GLU A CA 1 5: ATOM 933 C C . GLU A 1 118 ? 24.834 11.955 35.213 1.00 7.60 ? 118 GLU A C 1 5: ATOM 934 O O . GLU A 1 118 ? 23.872 11.565 35.885 1.00 8.05 ? 118 GLU A O 1 5: ATOM 935 C CB . GLU A 1 118 ? 26.776 10.653 34.241 1.00 8.86 ? 118 GLU A CB 1 5: ATOM 936 C CG . GLU A 1 118 ? 28.227 10.234 34.427 1.00 9.64 ? 118 GLU A CG 1 5: ATOM 937 C CD . GLU A 1 118 ? 28.770 9.370 33.310 1.00 13.39 ? 118 GLU A CD 1 5: ATOM 938 O OE1 . GLU A 1 118 ? 28.036 9.043 32.355 1.00 11.90 ? 118 GLU A OE1 1 5: ATOM 939 O OE2 . GLU A 1 118 ? 29.956 8.998 33.405 1.00 16.59 ? 118 GLU A OE2 1 5: ATOM 940 N N . LEU A 1 119 ? 24.732 12.884 34.269 1.00 7.57 ? 119 LEU A N 1 5: ATOM 941 C CA . LEU A 1 119 ? 23.467 13.513 33.917 1.00 6.94 ? 119 LEU A CA 1 5: ATOM 942 C C . LEU A 1 119 ? 23.189 13.277 32.431 1.00 8.29 ? 119 LEU A C 1 5: ATOM 943 O O . LEU A 1 119 ? 24.070 13.506 31.593 1.00 8.23 ? 119 LEU A O 1 5: ATOM 944 C CB . LEU A 1 119 ? 23.556 15.023 34.184 1.00 7.83 ? 119 LEU A CB 1 5: ATOM 945 C CG . LEU A 1 119 ? 22.417 15.972 33.810 1.00 9.54 ? 119 LEU A CG 1 5: ATOM 946 C CD1 . LEU A 1 119 ? 21.213 15.661 34.618 1.00 11.05 ? 119 LEU A CD1 1 5: ATOM 947 C CD2 . LEU A 1 119 ? 22.822 17.421 34.066 1.00 12.54 ? 119 LEU A CD2 1 5: ATOM 948 N N . ILE A 1 120 ? 22.010 12.743 32.119 1.00 6.17 ? 120 ILE A N 1 5: ATOM 949 C CA . ILE A 1 120 ? 21.638 12.529 30.730 1.00 6.22 ? 120 ILE A CA 1 5: ATOM 950 C C . ILE A 1 120 ? 20.527 13.511 30.354 1.00 7.47 ? 120 ILE A C 1 5: ATOM 951 O O . ILE A 1 120 ? 19.493 13.580 31.036 1.00 6.54 ? 120 ILE A O 1 5: ATOM 952 C CB . ILE A 1 120 ? 21.103 11.118 30.485 1.00 7.19 ? 120 ILE A CB 1 5: ATOM 953 C CG1 . ILE A 1 120 ? 22.171 10.070 30.801 1.00 8.26 ? 120 ILE A CG1 1 5: ATOM 954 C CG2 . ILE A 1 120 ? 20.556 11.003 29.047 1.00 6.54 ? 120 ILE A CG2 1 5: ATOM 955 C CD1 . ILE A 1 120 ? 21.668 8.658 30.600 1.00 9.35 ? 120 ILE A CD1 1 5: ATOM 956 N N . LEU A 1 121 ? 20.771 14.301 29.306 1.00 6.41 ? 121 LEU A N 1 5: ATOM 957 C CA . LEU A 1 121 ? 19.783 15.236 28.779 1.00 6.25 ? 121 LEU A CA 1 5: ATOM 958 C C . LEU A 1 121 ? 19.299 14.693 27.426 1.00 7.41 ? 121 LEU A C 1 5: ATOM 959 O O . LEU A 1 121 ? 20.115 14.242 26.619 1.00 6.01 ? 121 LEU A O 1 5: ATOM 960 C CB . LEU A 1 121 ? 20.400 16.624 28.526 1.00 7.37 ? 121 LEU A CB 1 5: ATOM 961 C CG . LEU A 1 121 ? 19.607 17.580 27.597 1.00 7.96 ? 121 LEU A CG 1 5: ATOM 962 C CD1 . LEU A 1 121 ? 18.340 18.117 28.290 1.00 7.91 ? 121 LEU A CD1 1 5: ATOM 963 C CD2 . LEU A 1 121 ? 20.501 18.739 27.151 1.00 7.96 ? 121 LEU A CD2 1 5: ATOM 964 N N . THR A 1 122 ? 17.988 14.607 27.222 1.00 6.71 ? 122 THR A N 1 5: ATOM 965 C CA . THR A 1 122 ? 17.514 14.205 25.898 1.00 7.80 ? 122 THR A CA 1 5: ATOM 966 C C . THR A 1 122 ? 16.633 15.334 25.402 1.00 8.58 ? 122 THR A C 1 5: ATOM 967 O O . THR A 1 122 ? 15.988 16.034 26.194 1.00 7.21 ? 122 THR A O 1 5: ATOM 968 C CB . THR A 1 122 ? 16.754 12.843 25.832 1.00 7.51 ? 122 THR A CB 1 5: ATOM 969 O OG1 . THR A 1 122 ? 15.422 12.992 26.313 1.00 9.27 ? 122 THR A OG1 1 5: ATOM 970 C CG2 . THR A 1 122 ? 17.484 11.759 26.622 1.00 7.86 ? 122 THR A CG2 1 5: ATOM 971 N N . MET A 1 123 ? 16.732 15.613 24.110 1.00 7.87 ? 123 MET A N 1 5: ATOM 972 C CA . MET A 1 123 ? 15.904 16.643 23.494 1.00 9.22 ? 123 MET A CA 1 5: ATOM 973 C C . MET A 1 123 ? 15.194 15.950 22.337 1.00 8.66 ? 123 MET A C 1 5: ATOM 974 O O . MET A 1 123 ? 15.828 15.189 21.601 1.00 8.09 ? 123 MET A O 1 5: ATOM 975 C CB . MET A 1 123 ? 16.760 17.818 23.019 1.00 9.37 ? 123 MET A CB 1 5: ATOM 976 C CG . MET A 1 123 ? 17.359 18.612 24.171 1.00 11.81 ? 123 MET A CG 1 5: ATOM 977 S SD . MET A 1 123 ? 18.325 20.048 23.658 1.00 16.59 ? 123 MET A SD 1 5: ATOM 978 C CE . MET A 1 123 ? 19.871 19.278 23.173 1.00 14.10 ? 123 MET A CE 1 5: ATOM 979 N N . THR A 1 124 ? 13.895 16.195 22.186 1.00 7.20 ? 124 THR A N 1 5: ATOM 980 C CA . THR A 1 124 ? 13.133 15.534 21.134 1.00 9.54 ? 124 THR A CA 1 5: ATOM 981 C C . THR A 1 124 ? 12.407 16.513 20.222 1.00 10.12 ? 124 THR A C 1 5: ATOM 982 O O . THR A 1 124 ? 11.941 17.563 20.665 1.00 9.54 ? 124 THR A O 1 5: ATOM 983 C CB . THR A 1 124 ? 12.073 14.552 21.756 1.00 10.74 ? 124 THR A CB 1 5: ATOM 984 O OG1 . THR A 1 124 ? 12.740 13.544 22.535 1.00 11.99 ? 124 THR A OG1 1 5: ATOM 985 C CG2 . THR A 1 124 ? 11.247 13.865 20.679 1.00 11.66 ? 124 THR A CG2 1 5: ATOM 986 N N . ALA A 1 125 ? 12.346 16.167 18.935 1.00 11.06 ? 125 ALA A N 1 5: ATOM 987 C CA . ALA A 1 125 ? 11.634 16.962 17.923 1.00 11.63 ? 125 ALA A CA 1 5: ATOM 988 C C . ALA A 1 125 ? 10.981 15.878 17.078 1.00 13.46 ? 125 ALA A C 1 5: ATOM 989 O O . ALA A 1 125 ? 11.669 15.144 16.352 1.00 13.11 ? 125 ALA A O 1 5: ATOM 990 C CB . ALA A 1 125 ? 12.603 17.786 17.091 1.00 13.16 ? 125 ALA A CB 1 5: ATOM 991 N N . ASP A 1 126 ? 9.664 15.754 17.216 1.00 14.63 ? 126 ASP A N 1 5: ATOM 992 C CA . ASP A 1 126 ? 8.901 14.721 16.536 1.00 17.86 ? 126 ASP A CA 1 5: ATOM 993 C C . ASP A 1 126 ? 9.512 13.364 16.905 1.00 18.66 ? 126 ASP A C 1 5: ATOM 994 O O . ASP A 1 126 ? 9.519 13.006 18.080 1.00 19.38 ? 126 ASP A O 1 5: ATOM 995 C CB . ASP A 1 126 ? 8.835 14.982 15.023 1.00 18.40 ? 126 ASP A CB 1 5: ATOM 996 C CG . ASP A 1 126 ? 7.786 16.032 14.660 1.00 22.34 ? 126 ASP A CG 1 5: ATOM 997 O OD1 . ASP A 1 126 ? 6.800 16.198 15.422 1.00 23.23 ? 126 ASP A OD1 1 5: ATOM 998 O OD2 . ASP A 1 126 ? 7.940 16.702 13.621 1.00 24.32 ? 126 ASP A OD2 1 5: ATOM 999 N N . ASP A 1 127 ? 10.064 12.629 15.945 1.00 20.19 ? 127 ASP A N 1 5: ATOM 1000 C CA . ASP A 1 127 ? 10.656 11.333 16.271 1.00 21.56 ? 127 ASP A CA 1 5: ATOM 1001 C C . ASP A 1 127 ? 12.175 11.279 16.416 1.00 18.85 ? 127 ASP A C 1 5: ATOM 1002 O O . ASP A 1 127 ? 12.732 10.219 16.657 1.00 20.67 ? 127 ASP A O 1 5: ATOM 1003 C CB . ASP A 1 127 ? 10.178 10.263 15.303 1.00 26.47 ? 127 ASP A CB 1 5: ATOM 1004 C CG . ASP A 1 127 ? 9.043 9.450 15.880 1.00 33.21 ? 127 ASP A CG 1 5: ATOM 1005 O OD1 . ASP A 1 127 ? 7.892 9.959 15.934 1.00 36.08 ? 127 ASP A OD1 1 5: ATOM 1006 O OD2 . ASP A 1 127 ? 9.318 8.308 16.318 1.00 38.35 ? 127 ASP A OD2 1 5: ATOM 1007 N N . VAL A 1 128 ? 12.836 12.418 16.281 1.00 15.22 ? 128 VAL A N 1 5: ATOM 1008 C CA . VAL A 1 128 ? 14.286 12.486 16.407 1.00 12.83 ? 128 VAL A CA 1 5: ATOM 1009 C C . VAL A 1 128 ? 14.681 12.843 17.835 1.00 11.58 ? 128 VAL A C 1 5: ATOM 1010 O O . VAL A 1 128 ? 14.176 13.811 18.408 1.00 9.74 ? 128 VAL A O 1 5: ATOM 1011 C CB . VAL A 1 128 ? 14.864 13.503 15.423 1.00 12.79 ? 128 VAL A CB 1 5: ATOM 1012 C CG1 . VAL A 1 128 ? 16.338 13.757 15.706 1.00 12.93 ? 128 VAL A CG1 1 5: ATOM 1013 C CG2 . VAL A 1 128 ? 14.677 12.968 14.005 1.00 14.30 ? 128 VAL A CG2 1 5: ATOM 1014 N N . VAL A 1 129 ? 15.586 12.051 18.397 1.00 9.29 ? 129 VAL A N 1 5: ATOM 1015 C CA . VAL A 1 129 ? 16.054 12.257 19.761 1.00 7.95 ? 129 VAL A CA 1 5: ATOM 1016 C C . VAL A 1 129 ? 17.558 12.546 19.842 1.00 7.49 ? 129 VAL A C 1 5: ATOM 1017 O O . VAL A 1 129 ? 18.374 11.816 19.276 1.00 8.73 ? 129 VAL A O 1 5: ATOM 1018 C CB . VAL A 1 129 ? 15.764 11.007 20.617 1.00 9.43 ? 129 VAL A CB 1 5: ATOM 1019 C CG1 . VAL A 1 129 ? 16.153 11.253 22.076 1.00 9.09 ? 129 VAL A CG1 1 5: ATOM 1020 C CG2 . VAL A 1 129 ? 14.293 10.610 20.495 1.00 9.45 ? 129 VAL A CG2 1 5: ATOM 1021 N N . CYS A 1 130 ? 17.912 13.630 20.534 1.00 7.54 ? 130 CYS A N 1 5: ATOM 1022 C CA . CYS A 1 130 ? 19.305 14.010 20.756 1.00 6.47 ? 130 CYS A CA 1 5: ATOM 1023 C C . CYS A 1 130 ? 19.670 13.627 22.200 1.00 6.61 ? 130 CYS A C 1 5: ATOM 1024 O O . CYS A 1 130 ? 18.955 13.992 23.135 1.00 7.53 ? 130 CYS A O 1 5: ATOM 1025 C CB . CYS A 1 130 ? 19.485 15.517 20.544 1.00 6.05 ? 130 CYS A CB 1 5: ATOM 1026 S SG . CYS A 1 130 ? 21.063 16.183 21.077 1.00 8.82 ? 130 CYS A SG 1 5: ATOM 1027 N N . THR A 1 131 ? 20.786 12.925 22.372 1.00 6.58 ? 131 THR A N 1 5: ATOM 1028 C CA . THR A 1 131 ? 21.241 12.462 23.693 1.00 5.93 ? 131 THR A CA 1 5: ATOM 1029 C C . THR A 1 131 ? 22.569 13.102 24.054 1.00 6.18 ? 131 THR A C 1 5: ATOM 1030 O O . THR A 1 131 ? 23.528 13.003 23.294 1.00 5.77 ? 131 THR A O 1 5: ATOM 1031 C CB . THR A 1 131 ? 21.419 10.914 23.699 1.00 6.63 ? 131 THR A CB 1 5: ATOM 1032 O OG1 . THR A 1 131 ? 20.199 10.299 23.289 1.00 7.60 ? 131 THR A OG1 1 5: ATOM 1033 C CG2 . THR A 1 131 ? 21.763 10.399 25.091 1.00 7.76 ? 131 THR A CG2 1 5: ATOM 1034 N N . ARG A 1 132 ? 22.624 13.780 25.202 1.00 6.29 ? 132 ARG A N 1 5: ATOM 1035 C CA . ARG A 1 132 ? 23.853 14.429 25.660 1.00 7.67 ? 132 ARG A CA 1 5: ATOM 1036 C C . ARG A 1 132 ? 24.108 13.960 27.093 1.00 7.19 ? 132 ARG A C 1 5: ATOM 1037 O O . ARG A 1 132 ? 23.184 13.895 27.902 1.00 8.65 ? 132 ARG A O 1 5: ATOM 1038 C CB . ARG A 1 132 ? 23.719 15.957 25.621 1.00 9.67 ? 132 ARG A CB 1 5: ATOM 1039 C CG . ARG A 1 132 ? 22.945 16.470 24.429 1.00 15.02 ? 132 ARG A CG 1 5: ATOM 1040 C CD . ARG A 1 132 ? 23.781 17.260 23.476 1.00 16.80 ? 132 ARG A CD 1 5: ATOM 1041 N NE . ARG A 1 132 ? 24.140 18.580 23.984 1.00 12.48 ? 132 ARG A NE 1 5: ATOM 1042 C CZ . ARG A 1 132 ? 25.030 19.377 23.395 1.00 12.93 ? 132 ARG A CZ 1 5: ATOM 1043 N NH1 . ARG A 1 132 ? 25.641 19.005 22.279 1.00 13.84 ? 132 ARG A NH1 1 5: ATOM 1044 N NH2 . ARG A 1 132 ? 25.398 20.506 23.973 1.00 11.57 ? 132 ARG A NH2 1 5: ATOM 1045 N N . VAL A 1 133 ? 25.359 13.633 27.397 1.00 5.99 ? 133 VAL A N 1 5: ATOM 1046 C CA . VAL A 1 133 ? 25.739 13.124 28.719 1.00 5.92 ? 133 VAL A CA 1 5: ATOM 1047 C C . VAL A 1 133 ? 26.773 14.055 29.345 1.00 5.85 ? 133 VAL A C 1 5: ATOM 1048 O O . VAL A 1 133 ? 27.713 14.492 28.681 1.00 5.50 ? 133 VAL A O 1 5: ATOM 1049 C CB . VAL A 1 133 ? 26.333 11.698 28.608 1.00 6.37 ? 133 VAL A CB 1 5: ATOM 1050 C CG1 . VAL A 1 133 ? 26.609 11.120 29.988 1.00 7.95 ? 133 VAL A CG1 1 5: ATOM 1051 C CG2 . VAL A 1 133 ? 25.385 10.782 27.832 1.00 6.46 ? 133 VAL A CG2 1 5: ATOM 1052 N N . TYR A 1 134 ? 26.619 14.337 30.635 1.00 5.35 ? 134 TYR A N 1 5: ATOM 1053 C CA . TYR A 1 134 ? 27.538 15.228 31.322 1.00 4.57 ? 134 TYR A CA 1 5: ATOM 1054 C C . TYR A 1 134 ? 28.014 14.611 32.617 1.00 5.30 ? 134 TYR A C 1 5: ATOM 1055 O O . TYR A 1 134 ? 27.371 13.712 33.165 1.00 3.92 ? 134 TYR A O 1 5: ATOM 1056 C CB . TYR A 1 134 ? 26.846 16.550 31.686 1.00 6.84 ? 134 TYR A CB 1 5: ATOM 1057 C CG . TYR A 1 134 ? 26.118 17.251 30.574 1.00 8.89 ? 134 TYR A CG 1 5: ATOM 1058 C CD1 . TYR A 1 134 ? 24.901 16.762 30.122 1.00 10.29 ? 134 TYR A CD1 1 5: ATOM 1059 C CD2 . TYR A 1 134 ? 26.628 18.406 29.992 1.00 10.49 ? 134 TYR A CD2 1 5: ATOM 1060 C CE1 . TYR A 1 134 ? 24.212 17.386 29.133 1.00 13.03 ? 134 TYR A CE1 1 5: ATOM 1061 C CE2 . TYR A 1 134 ? 25.930 19.051 28.982 1.00 12.15 ? 134 TYR A CE2 1 5: ATOM 1062 C CZ . TYR A 1 134 ? 24.723 18.517 28.567 1.00 12.80 ? 134 TYR A CZ 1 5: ATOM 1063 O OH . TYR A 1 134 ? 23.991 19.082 27.567 1.00 18.07 ? 134 TYR A OH 1 5: ATOM 1064 N N . VAL A 1 135 ? 29.113 15.158 33.119 1.00 6.63 ? 135 VAL A N 1 5: ATOM 1065 C CA . VAL A 1 135 ? 29.697 14.762 34.394 1.00 8.42 ? 135 VAL A CA 1 5: ATOM 1066 C C . VAL A 1 135 ? 30.100 16.086 35.064 1.00 9.05 ? 135 VAL A C 1 5: ATOM 1067 O O . VAL A 1 135 ? 30.340 17.086 34.385 1.00 9.02 ? 135 VAL A O 1 5: ATOM 1068 C CB . VAL A 1 135 ? 30.925 13.815 34.204 1.00 8.05 ? 135 VAL A CB 1 5: ATOM 1069 C CG1 . VAL A 1 135 ? 32.109 14.556 33.596 1.00 9.27 ? 135 VAL A CG1 1 5: ATOM 1070 C CG2 . VAL A 1 135 ? 31.304 13.151 35.533 1.00 10.37 ? 135 VAL A CG2 1 5: ATOM 1071 N N . ARG A 1 136 ? 30.117 16.133 36.390 1.00 9.57 ? 136 ARG A N 1 5: ATOM 1072 C CA . ARG A 1 136 ? 30.498 17.375 37.040 1.00 10.86 ? 136 ARG A CA 1 5: ATOM 1073 C C . ARG A 1 136 ? 31.964 17.676 36.776 1.00 11.68 ? 136 ARG A C 1 5: ATOM 1074 O O . ARG A 1 136 ? 32.782 16.765 36.686 1.00 11.35 ? 136 ARG A O 1 5: ATOM 1075 C CB . ARG A 1 136 ? 30.221 17.319 38.536 1.00 11.99 ? 136 ARG A CB 1 5: ATOM 1076 C CG . ARG A 1 136 ? 28.746 17.454 38.885 1.00 13.89 ? 136 ARG A CG 1 5: ATOM 1077 C CD . ARG A 1 136 ? 28.576 17.533 40.382 1.00 15.85 ? 136 ARG A CD 1 5: ATOM 1078 N NE . ARG A 1 136 ? 27.185 17.407 40.754 1.00 17.08 ? 136 ARG A NE 1 5: ATOM 1079 C CZ . ARG A 1 136 ? 26.561 16.245 40.926 1.00 21.69 ? 136 ARG A CZ 1 5: ATOM 1080 N NH1 . ARG A 1 136 ? 27.217 15.102 40.754 1.00 23.26 ? 136 ARG A NH1 1 5: ATOM 1081 N NH2 . ARG A 1 136 ? 25.278 16.227 41.283 1.00 22.60 ? 136 ARG A NH2 1 5: ATOM 1082 N N . GLU A 1 137 ? 32.282 18.963 36.663 1.00 15.12 ? 137 GLU A N 1 5: ATOM 1083 C CA . GLU A 1 137 ? 33.641 19.430 36.400 1.00 18.00 ? 137 GLU A CA 1 5: ATOM 1084 C C . GLU A 1 137 ? 34.615 19.038 37.493 1.00 18.96 ? 137 GLU A C 1 5: ATOM 1085 O O . GLU A 1 137 ? 34.221 19.175 38.659 1.00 17.37 ? 137 GLU A O 1 5: ATOM 1086 C CB . GLU A 1 137 ? 33.661 20.943 36.293 1.00 19.89 ? 137 GLU A CB 1 5: ATOM 1087 C CG . GLU A 1 137 ? 33.092 21.492 35.035 1.00 28.03 ? 137 GLU A CG 1 5: ATOM 1088 C CD . GLU A 1 137 ? 33.469 22.953 34.865 1.00 33.22 ? 137 GLU A CD 1 5: ATOM 1089 O OE1 . GLU A 1 137 ? 34.630 23.217 34.473 1.00 37.31 ? 137 GLU A OE1 1 5: ATOM 1090 O OE2 . GLU A 1 137 ? 32.636 23.836 35.164 1.00 36.38 ? 137 GLU A OE2 1 5: ATOM 1091 O OXT . GLU A 1 137 ? 35.776 18.680 37.173 1.00 22.23 ? 137 GLU A OXT 1 5: HETATM 1092 C C1 . RXA B 4 . ? 21.972 29.831 16.739 1.00 15.25 ? 200 RXA A C1 1 5: HETATM 1093 C C2 . RXA B 4 . ? 20.921 30.524 15.841 1.00 15.61 ? 200 RXA A C2 1 5: HETATM 1094 C C3 . RXA B 4 . ? 20.245 29.635 14.848 1.00 16.19 ? 200 RXA A C3 1 5: HETATM 1095 C C4 . RXA B 4 . ? 19.555 28.479 15.488 1.00 14.59 ? 200 RXA A C4 1 5: HETATM 1096 C C5 . RXA B 4 . ? 20.389 27.812 16.587 1.00 14.10 ? 200 RXA A C5 1 5: HETATM 1097 C C6 . RXA B 4 . ? 21.425 28.446 17.218 1.00 14.42 ? 200 RXA A C6 1 5: HETATM 1098 C C7 . RXA B 4 . ? 22.242 27.851 18.297 1.00 13.89 ? 200 RXA A C7 1 5: HETATM 1099 C C8 . RXA B 4 . ? 21.868 26.977 19.240 1.00 11.86 ? 200 RXA A C8 1 5: HETATM 1100 C C9 . RXA B 4 . ? 22.705 26.434 20.286 1.00 10.87 ? 200 RXA A C9 1 5: HETATM 1101 C C10 . RXA B 4 . ? 22.159 25.536 21.131 1.00 9.19 ? 200 RXA A C10 1 5: HETATM 1102 C C11 . RXA B 4 . ? 22.875 24.924 22.234 1.00 10.35 ? 200 RXA A C11 1 5: HETATM 1103 C C12 . RXA B 4 . ? 22.237 24.026 22.990 1.00 10.53 ? 200 RXA A C12 1 5: HETATM 1104 C C13 . RXA B 4 . ? 22.856 23.377 24.125 1.00 10.91 ? 200 RXA A C13 1 5: HETATM 1105 C C14 . RXA B 4 . ? 22.135 22.473 24.834 1.00 11.88 ? 200 RXA A C14 1 5: HETATM 1106 C C15 . RXA B 4 . ? 22.563 21.710 26.016 1.00 14.86 ? 200 RXA A C15 1 5: HETATM 1107 C C16 . RXA B 4 . ? 22.238 30.737 17.948 1.00 15.47 ? 200 RXA A C16 1 5: HETATM 1108 C C17 . RXA B 4 . ? 23.292 29.620 15.948 1.00 13.42 ? 200 RXA A C17 1 5: HETATM 1109 C C18 . RXA B 4 . ? 19.791 26.449 16.947 1.00 12.61 ? 200 RXA A C18 1 5: HETATM 1110 C C19 . RXA B 4 . ? 24.181 26.841 20.385 1.00 10.08 ? 200 RXA A C19 1 5: HETATM 1111 C C20 . RXA B 4 . ? 24.303 23.747 24.489 1.00 10.10 ? 200 RXA A C20 1 5: HETATM 1112 O O1 . RXA B 4 . ? 23.640 21.075 25.978 1.00 13.29 ? 200 RXA A O1 1 5: HETATM 1113 O O2 . RXA B 4 . ? 21.840 21.712 27.037 1.00 10.99 ? 200 RXA A O2 1 5: HETATM 1114 O O . HOH C 3 . ? 21.817 19.604 31.169 1.00 17.43 ? 300 HOH A O 1 5: HETATM 1115 O O . HOH C 3 . ? 7.617 26.892 37.107 1.00 12.66 ? 301 HOH A O 1 5: HETATM 1116 O O . HOH C 3 . ? 22.885 27.835 25.056 1.00 18.86 ? 302 HOH A O 1 5: HETATM 1117 O O . HOH C 3 . ? 30.685 27.402 22.818 1.00 14.12 ? 303 HOH A O 1 5: HETATM 1118 O O . HOH C 3 . ? 29.930 20.839 40.398 1.00 16.48 ? 304 HOH A O 1 5: HETATM 1119 O O . HOH C 3 . ? 31.492 21.096 28.452 1.00 16.65 ? 305 HOH A O 1 5: HETATM 1120 O O . HOH C 3 . ? 19.459 26.601 30.320 1.00 9.81 ? 306 HOH A O 1 5: HETATM 1121 O O . HOH C 3 . ? 19.116 26.759 22.930 1.00 22.33 ? 307 HOH A O 1 5: HETATM 1122 O O . HOH C 3 . ? 16.356 22.299 28.453 1.00 35.46 ? 308 HOH A O 1 5: HETATM 1123 O O . HOH C 3 . ? 21.823 21.939 29.734 1.00 13.95 ? 309 HOH A O 1 5: HETATM 1124 O O . HOH C 3 . ? 13.206 22.267 22.102 1.00 20.07 ? 310 HOH A O 1 5: HETATM 1125 O O . HOH C 3 . ? 30.300 22.803 12.740 1.00 24.70 ? 311 HOH A O 1 5: HETATM 1126 O O . HOH C 3 . ? 7.344 23.059 35.600 1.00 8.82 ? 312 HOH A O 1 5: HETATM 1127 O O . HOH C 3 . ? 6.876 22.668 20.375 1.00 29.74 ? 313 HOH A O 1 5: HETATM 1128 O O . HOH C 3 . ? 17.917 24.800 29.159 1.00 23.69 ? 314 HOH A O 1 5: HETATM 1129 O O . HOH C 3 . ? 37.101 16.714 38.714 1.00 19.84 ? 315 HOH A O 1 5: HETATM 1130 O O . HOH C 3 . ? 28.721 7.425 30.043 1.00 14.94 ? 316 HOH A O 1 5: HETATM 1131 O O . HOH C 3 . ? 13.212 14.450 25.193 1.00 18.03 ? 317 HOH A O 1 5: HETATM 1132 O O . HOH C 3 . ? 6.094 9.777 39.151 1.00 13.98 ? 318 HOH A O 1 5: HETATM 1133 O O . HOH C 3 . ? 19.296 10.379 13.144 1.00 27.20 ? 319 HOH A O 1 5: HETATM 1134 O O . HOH C 3 . ? 25.337 10.931 16.577 1.00 18.41 ? 320 HOH A O 1 5: HETATM 1135 O O . HOH C 3 . ? 25.244 34.269 18.193 1.00 9.65 ? 321 HOH A O 1 5: HETATM 1136 O O . HOH C 3 . ? 23.567 10.727 14.429 1.00 11.13 ? 322 HOH A O 1 5: HETATM 1137 O O . HOH C 3 . ? 17.151 12.178 30.238 1.00 11.53 ? 323 HOH A O 1 5: HETATM 1138 O O . HOH C 3 . ? 27.768 11.967 42.077 1.00 23.33 ? 324 HOH A O 1 5: HETATM 1139 O O . HOH C 3 . ? 30.270 12.554 21.386 1.00 25.05 ? 325 HOH A O 1 5: HETATM 1140 O O . HOH C 3 . ? 25.662 15.488 18.515 1.00 10.80 ? 326 HOH A O 1 5: HETATM 1141 O O . HOH C 3 . ? 4.514 21.426 18.685 1.00 45.94 ? 327 HOH A O 1 5: HETATM 1142 O O . HOH C 3 . ? 8.081 23.201 17.690 1.00 30.16 ? 328 HOH A O 1 5: HETATM 1143 O O . HOH C 3 . ? 13.242 29.389 14.924 1.00 39.93 ? 329 HOH A O 1 5: HETATM 1144 O O . HOH C 3 . ? 10.514 18.772 10.176 1.00 33.65 ? 330 HOH A O 1 5: HETATM 1145 O O . HOH C 3 . ? 10.555 13.666 26.313 1.00 32.55 ? 331 HOH A O 1 5: HETATM 1146 O O . HOH C 3 . ? 5.189 16.418 31.375 1.00 35.78 ? 332 HOH A O 1 5: HETATM 1147 O O . HOH C 3 . ? 0.738 25.633 36.349 1.00 29.00 ? 333 HOH A O 1 5: HETATM 1148 O O . HOH C 3 . ? 2.976 28.966 37.321 1.00 40.14 ? 334 HOH A O 1 5: HETATM 1149 O O . HOH C 3 . ? 6.424 28.750 38.849 1.00 32.17 ? 335 HOH A O 1 5: HETATM 1150 O O . HOH C 3 . ? 12.503 30.488 31.704 1.00 41.11 ? 336 HOH A O 1 5: HETATM 1151 O O . HOH C 3 . ? 14.979 30.157 27.559 1.00 23.78 ? 337 HOH A O 1 5: HETATM 1152 O O . HOH C 3 . ? 17.312 32.981 28.812 1.00 20.84 ? 338 HOH A O 1 5: HETATM 1153 O O . HOH C 3 . ? 29.473 25.946 34.693 1.00 29.05 ? 339 HOH A O 1 5: HETATM 1154 O O . HOH C 3 . ? 30.328 23.817 33.494 1.00 24.17 ? 340 HOH A O 1 5: HETATM 1155 O O . HOH C 3 . ? 31.158 28.144 26.433 1.00 42.66 ? 341 HOH A O 1 5: HETATM 1156 O O . HOH C 3 . ? 30.276 28.397 16.400 1.00 21.90 ? 342 HOH A O 1 5: HETATM 1157 O O . HOH C 3 . ? 19.533 23.600 26.857 1.00 21.12 ? 343 HOH A O 1 5: HETATM 1158 O O . HOH C 3 . ? 17.892 24.675 24.549 1.00 48.11 ? 344 HOH A O 1 5: HETATM 1159 O O . HOH C 3 . ? 14.211 24.152 25.435 1.00 21.09 ? 345 HOH A O 1 5: HETATM 1160 O O . HOH C 3 . ? 15.223 27.626 27.056 1.00 27.16 ? 346 HOH A O 1 5: HETATM 1161 O O . HOH C 3 . ? 3.502 22.911 43.083 1.00 30.15 ? 347 HOH A O 1 5: HETATM 1162 O O . HOH C 3 . ? 20.610 7.668 40.212 1.00 49.06 ? 348 HOH A O 1 5: HETATM 1163 O O . HOH C 3 . ? 24.813 2.899 36.403 1.00 48.98 ? 349 HOH A O 1 5: HETATM 1164 O O . HOH C 3 . ? 29.900 5.163 26.918 1.00 23.60 ? 350 HOH A O 1 5: HETATM 1165 O O . HOH C 3 . ? 14.333 5.466 42.757 1.00 22.90 ? 351 HOH A O 1 5: HETATM 1166 O O . HOH C 3 . ? 8.914 5.771 35.515 1.00 35.92 ? 352 HOH A O 1 5: HETATM 1167 O O . HOH C 3 . ? 14.519 28.906 40.193 1.00 28.73 ? 353 HOH A O 1 5: HETATM 1168 O O . HOH C 3 . ? 17.573 20.203 47.080 1.00 37.63 ? 354 HOH A O 1 5: HETATM 1169 O O . HOH C 3 . ? 13.324 32.251 34.152 1.00 47.79 ? 355 HOH A O 1 5: HETATM 1170 O O . HOH C 3 . ? 12.491 24.840 7.594 1.00 39.45 ? 356 HOH A O 1 5: HETATM 1171 O O . HOH C 3 . ? 25.066 15.777 15.214 1.00 27.39 ? 357 HOH A O 1 5: HETATM 1172 O O . HOH C 3 . ? 27.138 17.638 17.834 1.00 45.12 ? 358 HOH A O 1 5: HETATM 1173 O O . HOH C 3 . ? 27.611 19.792 19.503 1.00 24.45 ? 359 HOH A O 1 5: HETATM 1174 O O . HOH C 3 . ? 11.358 8.880 19.119 1.00 24.31 ? 360 HOH A O 1 5: HETATM 1175 O O . HOH C 3 . ? 16.252 27.169 24.557 1.00 25.40 ? 361 HOH A O 1 5: HETATM 1176 O O . HOH C 3 . ? 22.049 27.870 4.565 1.00 25.37 ? 362 HOH A O 1 5: HETATM 1177 O O . HOH C 3 . ? 11.533 6.689 34.501 1.00 29.92 ? 363 HOH A O 1 5: HETATM 1178 O O . HOH C 3 . ? 13.269 4.551 36.338 1.00 45.75 ? 364 HOH A O 1 5: HETATM 1179 O O . HOH C 3 . ? 23.149 9.493 41.173 1.00 30.10 ? 365 HOH A O 1 5: HETATM 1180 O O . HOH C 3 . ? 21.090 12.171 43.973 1.00 27.97 ? 366 HOH A O 1 5: HETATM 1181 O O . HOH C 3 . ? 11.884 13.399 42.560 1.00 23.28 ? 367 HOH A O 1 5: HETATM 1182 O O . HOH C 3 . ? 29.542 17.520 20.025 1.00 38.32 ? 368 HOH A O 1 5: HETATM 1183 O O . HOH C 3 . ? 31.058 17.427 22.538 1.00 37.85 ? 369 HOH A O 1 5: HETATM 1184 O O . HOH C 3 . ? 31.928 9.444 23.294 1.00 46.07 ? 370 HOH A O 1 5: HETATM 1185 O O . HOH C 3 . ? 25.699 10.933 9.557 1.00 44.12 ? 371 HOH A O 1 5: HETATM 1186 O O . HOH C 3 . ? 26.533 13.428 16.334 1.00 45.21 ? 372 HOH A O 1 5: HETATM 1187 O O . HOH C 3 . ? 27.078 16.850 13.245 1.00 39.52 ? 373 HOH A O 1 5: HETATM 1188 O O . HOH C 3 . ? 20.596 32.070 6.807 1.00 36.38 ? 374 HOH A O 1 5: HETATM 1189 O O . HOH C 3 . ? 17.126 28.421 9.515 1.00 23.81 ? 375 HOH A O 1 5: HETATM 1190 O O . HOH C 3 . ? 16.626 32.383 11.231 1.00 20.11 ? 376 HOH A O 1 5: HETATM 1191 O O . HOH C 3 . ? 6.046 30.510 19.639 1.00 29.02 ? 377 HOH A O 1 5: HETATM 1192 O O . HOH C 3 . ? 9.543 16.072 11.145 1.00 50.91 ? 378 HOH A O 1 5: HETATM 1193 O O . HOH C 3 . ? 8.174 14.289 20.240 1.00 54.21 ? 379 HOH A O 1 5: HETATM 1194 O O . HOH C 3 . ? 11.561 10.834 22.873 1.00 43.23 ? 380 HOH A O 1 5: HETATM 1195 O O . HOH C 3 . ? 5.486 15.385 24.922 1.00 50.19 ? 381 HOH A O 1 5: HETATM 1196 O O . HOH C 3 . ? 6.038 21.424 43.276 1.00 46.64 ? 382 HOH A O 1 5: HETATM 1197 O O . HOH C 3 . ? 34.144 19.165 27.284 1.00 41.41 ? 383 HOH A O 1 5: HETATM 1198 O O . HOH C 3 . ? 16.916 27.142 42.621 1.00 29.32 ? 384 HOH A O 1 5: HETATM 1199 O O . HOH C 3 . ? 25.509 24.918 41.520 1.00 32.12 ? 385 HOH A O 1 5: HETATM 1200 O O . HOH C 3 . ? 31.446 7.504 31.389 1.00 28.93 ? 386 HOH A O 1 5: HETATM 1201 O O . HOH C 3 . ? 18.212 20.893 5.892 1.00 29.90 ? 387 HOH A O 1 5: HETATM 1202 O O . HOH C 3 . ? 15.148 27.608 7.685 1.00 30.91 ? 388 HOH A O 1 5: HETATM 1203 O O . HOH C 3 . ? 2.656 23.148 20.117 1.00 35.98 ? 389 HOH A O 1 5: HETATM 1204 O O . HOH C 3 . ? 3.100 22.690 28.640 1.00 31.31 ? 390 HOH A O 1 5: HETATM 1205 O O . HOH C 3 . ? 13.699 19.720 21.819 1.00 26.56 ? 391 HOH A O 1 5: HETATM 1206 O O . HOH C 3 . ? 26.833 28.283 32.272 1.00 31.48 ? 392 HOH A O 1 5: HETATM 1207 O O . HOH C 3 . ? 20.458 26.214 25.811 1.00 24.39 ? 393 HOH A O 1 5: HETATM 1208 O O . HOH C 3 . ? 32.304 27.731 18.152 1.00 41.66 ? 394 HOH A O 1 5: HETATM 1209 O O . HOH C 3 . ? 24.283 13.868 42.687 1.00 35.59 ? 395 HOH A O 1 5: HETATM 1210 O O . HOH C 3 . ? 11.833 12.657 45.160 1.00 38.30 ? 396 HOH A O 1 5: HETATM 1211 O O . HOH C 3 . ? 1.988 27.992 43.589 1.00 33.97 ? 397 HOH A O 1 5: HETATM 1212 O O . HOH C 3 . ? 32.913 22.982 40.176 1.00 39.26 ? 398 HOH A O 1 5: HETATM 1213 O O . HOH C 3 . ? 32.435 20.043 40.169 1.00 33.87 ? 399 HOH A O 1 5: # 5: loop_ 5: _pdbx_validate_torsion.id 5: _pdbx_validate_torsion.PDB_model_num 5: _pdbx_validate_torsion.auth_comp_id 5: _pdbx_validate_torsion.auth_asym_id 5: _pdbx_validate_torsion.auth_seq_id 5: _pdbx_validate_torsion.PDB_ins_code 5: _pdbx_validate_torsion.label_alt_id 5: _pdbx_validate_torsion.phi 5: _pdbx_validate_torsion.psi 5: 1 1 GLU A 73 ? ? -144.94 -154.28 5: 2 1 ASP A 126 ? ? 55.69 -115.96 5: # 5: loop_ 5: _struct_site_gen.id 5: _struct_site_gen.site_id 5: _struct_site_gen.pdbx_num_res 5: _struct_site_gen.label_comp_id 5: _struct_site_gen.label_asym_id 5: _struct_site_gen.label_seq_id 5: _struct_site_gen.pdbx_auth_ins_code 5: _struct_site_gen.auth_comp_id 5: _struct_site_gen.auth_asym_id 5: _struct_site_gen.auth_seq_id 5: _struct_site_gen.label_atom_id 5: _struct_site_gen.label_alt_id 5: _struct_site_gen.symmetry 5: _struct_site_gen.details 5: 1 AC1 10 GLU A 13 ? GLU A 13 . ? 3_655 ? 5: 2 AC1 10 ALA A 32 ? ALA A 32 . ? 1_555 ? 5: 3 AC1 10 THR A 54 ? THR A 54 . ? 1_555 ? 5: 4 AC1 10 VAL A 58 ? VAL A 58 . ? 1_555 ? 5: 5 AC1 10 VAL A 76 ? VAL A 76 . ? 1_555 ? 5: 6 AC1 10 LEU A 121 ? LEU A 121 . ? 1_555 ? 5: 7 AC1 10 ARG A 132 ? ARG A 132 . ? 1_555 ? 5: 8 AC1 10 TYR A 134 ? TYR A 134 . ? 1_555 ? 5: 9 AC1 10 HOH C . ? HOH A 309 . ? 1_555 ? 5: 10 AC1 10 HOH C . ? HOH A 343 . ? 1_555 ? 5: # 5: loop_ 5: _pdbx_nonpoly_scheme.asym_id 5: _pdbx_nonpoly_scheme.entity_id 5: _pdbx_nonpoly_scheme.mon_id 5: _pdbx_nonpoly_scheme.ndb_seq_num 5: _pdbx_nonpoly_scheme.pdb_seq_num 5: _pdbx_nonpoly_scheme.auth_seq_num 5: _pdbx_nonpoly_scheme.pdb_mon_id 5: _pdbx_nonpoly_scheme.auth_mon_id 5: _pdbx_nonpoly_scheme.pdb_strand_id 5: _pdbx_nonpoly_scheme.pdb_ins_code 5: B 4 RXA 1 200 200 RXA RXA A . 5: C 3 HOH 1 300 300 HOH HOH A . 5: C 3 HOH 2 301 301 HOH HOH A . 5: C 3 HOH 3 302 302 HOH HOH A . 5: C 3 HOH 4 303 303 HOH HOH A . 5: C 3 HOH 5 304 304 HOH HOH A . 5: C 3 HOH 6 305 305 HOH HOH A . 5: C 3 HOH 7 306 306 HOH HOH A . 5: C 3 HOH 8 307 307 HOH HOH A . 5: C 3 HOH 9 308 308 HOH HOH A . 5: C 3 HOH 10 309 309 HOH HOH A . 5: C 3 HOH 11 310 310 HOH HOH A . 5: C 3 HOH 12 311 311 HOH HOH A . 5: C 3 HOH 13 312 312 HOH HOH A . 5: C 3 HOH 14 313 313 HOH HOH A . 5: C 3 HOH 15 314 314 HOH HOH A . 5: C 3 HOH 16 315 315 HOH HOH A . 5: C 3 HOH 17 316 316 HOH HOH A . 5: C 3 HOH 18 317 317 HOH HOH A . 5: C 3 HOH 19 318 318 HOH HOH A . 5: C 3 HOH 20 319 319 HOH HOH A . 5: C 3 HOH 21 320 320 HOH HOH A . 5: C 3 HOH 22 321 321 HOH HOH A . 5: C 3 HOH 23 322 322 HOH HOH A . 5: C 3 HOH 24 323 323 HOH HOH A . 5: C 3 HOH 25 324 324 HOH HOH A . 5: C 3 HOH 26 325 325 HOH HOH A . 5: C 3 HOH 27 326 326 HOH HOH A . 5: C 3 HOH 28 327 327 HOH HOH A . 5: C 3 HOH 29 328 328 HOH HOH A . 5: C 3 HOH 30 329 329 HOH HOH A . 5: C 3 HOH 31 330 330 HOH HOH A . 5: C 3 HOH 32 331 331 HOH HOH A . 5: C 3 HOH 33 332 332 HOH HOH A . 5: C 3 HOH 34 333 333 HOH HOH A . 5: C 3 HOH 35 334 334 HOH HOH A . 5: C 3 HOH 36 335 335 HOH HOH A . 5: C 3 HOH 37 336 336 HOH HOH A . 5: C 3 HOH 38 337 337 HOH HOH A . 5: C 3 HOH 39 338 338 HOH HOH A . 5: C 3 HOH 40 339 339 HOH HOH A . 5: C 3 HOH 41 340 340 HOH HOH A . 5: C 3 HOH 42 341 341 HOH HOH A . 5: C 3 HOH 43 342 342 HOH HOH A . 5: C 3 HOH 44 343 343 HOH HOH A . 5: C 3 HOH 45 344 344 HOH HOH A . 5: C 3 HOH 46 345 345 HOH HOH A . 5: C 3 HOH 47 346 346 HOH HOH A . 5: C 3 HOH 48 347 347 HOH HOH A . 5: C 3 HOH 49 348 348 HOH HOH A . 5: C 3 HOH 50 349 349 HOH HOH A . 5: C 3 HOH 51 350 350 HOH HOH A . 5: C 3 HOH 52 351 351 HOH HOH A . 5: C 3 HOH 53 352 352 HOH HOH A . 5: C 3 HOH 54 353 353 HOH HOH A . 5: C 3 HOH 55 354 354 HOH HOH A . 5: C 3 HOH 56 355 355 HOH HOH A . 5: C 3 HOH 57 356 356 HOH HOH A . 5: C 3 HOH 58 357 357 HOH HOH A . 5: C 3 HOH 59 358 358 HOH HOH A . 5: C 3 HOH 60 359 359 HOH HOH A . 5: C 3 HOH 61 360 360 HOH HOH A . 5: C 3 HOH 62 361 361 HOH HOH A . 5: C 3 HOH 63 362 362 HOH HOH A . 5: C 3 HOH 64 363 363 HOH HOH A . 5: C 3 HOH 65 364 364 HOH HOH A . 5: C 3 HOH 66 365 365 HOH HOH A . 5: C 3 HOH 67 366 366 HOH HOH A . 5: C 3 HOH 68 367 367 HOH HOH A . 5: C 3 HOH 69 368 368 HOH HOH A . 5: C 3 HOH 70 369 369 HOH HOH A . 5: C 3 HOH 71 370 370 HOH HOH A . 5: C 3 HOH 72 371 371 HOH HOH A . 5: C 3 HOH 73 372 372 HOH HOH A . 5: C 3 HOH 74 373 373 HOH HOH A . 5: C 3 HOH 75 374 374 HOH HOH A . 5: C 3 HOH 76 375 375 HOH HOH A . 5: C 3 HOH 77 376 376 HOH HOH A . 5: C 3 HOH 78 377 377 HOH HOH A . 5: C 3 HOH 79 378 378 HOH HOH A . 5: C 3 HOH 80 379 379 HOH HOH A . 5: C 3 HOH 81 380 380 HOH HOH A . 5: C 3 HOH 82 381 381 HOH HOH A . 5: C 3 HOH 83 382 382 HOH HOH A . 5: C 3 HOH 84 383 383 HOH HOH A . 5: C 3 HOH 85 384 384 HOH HOH A . 5: C 3 HOH 86 385 385 HOH HOH A . 5: C 3 HOH 87 386 386 HOH HOH A . 5: C 3 HOH 88 387 387 HOH HOH A . 5: C 3 HOH 89 388 388 HOH HOH A . 5: C 3 HOH 90 389 389 HOH HOH A . 5: C 3 HOH 91 390 390 HOH HOH A . 5: C 3 HOH 92 391 391 HOH HOH A . 5: C 3 HOH 93 392 392 HOH HOH A . 5: C 3 HOH 94 393 393 HOH HOH A . 5: C 3 HOH 95 394 394 HOH HOH A . 5: C 3 HOH 96 395 395 HOH HOH A . 5: C 3 HOH 97 396 396 HOH HOH A . 5: C 3 HOH 98 397 397 HOH HOH A . 5: C 3 HOH 99 398 398 HOH HOH A . 5: C 3 HOH 100 399 399 HOH HOH A . 5: # 5: loop_ 5: _pdbx_entity_nonpoly.entity_id 5: _pdbx_entity_nonpoly.name 5: _pdbx_entity_nonpoly.comp_id 5: 3 water HOH 5: 4 'RENAMED RETINOIC ACID' RXA 5: # 5: _struct_ref_seq.align_id 1 5: _struct_ref_seq.ref_id 1 5: _struct_ref_seq.pdbx_PDB_id_code 1CBS 5: _struct_ref_seq.pdbx_strand_id A 5: _struct_ref_seq.seq_align_beg 1 5: _struct_ref_seq.pdbx_seq_align_beg_ins_code ? 5: _struct_ref_seq.seq_align_end 137 5: _struct_ref_seq.pdbx_seq_align_end_ins_code ? 5: _struct_ref_seq.pdbx_db_accession P29373 5: _struct_ref_seq.db_align_beg 1 5: _struct_ref_seq.pdbx_db_align_beg_ins_code ? 5: _struct_ref_seq.db_align_end 137 5: _struct_ref_seq.pdbx_db_align_end_ins_code ? 5: _struct_ref_seq.pdbx_auth_seq_align_beg 1 5: _struct_ref_seq.pdbx_auth_seq_align_end 137 5: # 5: loop_ 5: _struct_sheet_range.sheet_id 5: _struct_sheet_range.id 5: _struct_sheet_range.beg_label_comp_id 5: _struct_sheet_range.beg_label_asym_id 5: _struct_sheet_range.beg_label_seq_id 5: _struct_sheet_range.pdbx_beg_PDB_ins_code 5: _struct_sheet_range.end_label_comp_id 5: _struct_sheet_range.end_label_asym_id 5: _struct_sheet_range.end_label_seq_id 5: _struct_sheet_range.pdbx_end_PDB_ins_code 5: _struct_sheet_range.beg_auth_comp_id 5: _struct_sheet_range.beg_auth_asym_id 5: _struct_sheet_range.beg_auth_seq_id 5: _struct_sheet_range.end_auth_comp_id 5: _struct_sheet_range.end_auth_asym_id 5: _struct_sheet_range.end_auth_seq_id 5: A 1 THR A 60 ? LYS A 66 ? THR A 60 LYS A 66 5: A 2 THR A 49 ? SER A 55 ? THR A 49 SER A 55 5: A 3 ALA A 40 ? GLU A 46 ? ALA A 40 GLU A 46 5: A 4 GLY A 5 ? GLU A 13 ? GLY A 5 GLU A 13 5: A 5 VAL A 128 ? ARG A 136 ? VAL A 128 ARG A 136 5: A 6 LEU A 119 ? ALA A 125 ? LEU A 119 ALA A 125 5: A 7 THR A 107 ? LEU A 113 ? THR A 107 LEU A 113 5: A 8 LYS A 92 ? LEU A 99 ? LYS A 92 LEU A 99 5: A 9 PRO A 80 ? SER A 89 ? PRO A 80 SER A 89 5: A 10 PHE A 71 ? GLN A 74 ? PHE A 71 GLN A 74 5: # 5: loop_ 5: _struct_conf.conf_type_id 5: _struct_conf.id 5: _struct_conf.pdbx_PDB_helix_id 5: _struct_conf.beg_label_comp_id 5: _struct_conf.beg_label_asym_id 5: _struct_conf.beg_label_seq_id 5: _struct_conf.pdbx_beg_PDB_ins_code 5: _struct_conf.end_label_comp_id 5: _struct_conf.end_label_asym_id 5: _struct_conf.end_label_seq_id 5: _struct_conf.pdbx_end_PDB_ins_code 5: _struct_conf.beg_auth_comp_id 5: _struct_conf.beg_auth_asym_id 5: _struct_conf.beg_auth_seq_id 5: _struct_conf.end_auth_comp_id 5: _struct_conf.end_auth_asym_id 5: _struct_conf.end_auth_seq_id 5: _struct_conf.pdbx_PDB_helix_class 5: _struct_conf.details 5: _struct_conf.pdbx_PDB_helix_length 5: HELX_P HELX_P1 1 ASN A 14 ? LEU A 22 ? ASN A 14 LEU A 22 1 ? 9 5: HELX_P HELX_P2 2 ASN A 25 ? SER A 37 ? ASN A 25 SER A 37 1 ? 13 5: # 5: loop_ 5: _struct_sheet_order.sheet_id 5: _struct_sheet_order.range_id_1 5: _struct_sheet_order.range_id_2 5: _struct_sheet_order.offset 5: _struct_sheet_order.sense 5: A 1 2 ? anti-parallel 5: A 2 3 ? anti-parallel 5: A 3 4 ? anti-parallel 5: A 4 5 ? anti-parallel 5: A 5 6 ? anti-parallel 5: A 6 7 ? anti-parallel 5: A 7 8 ? anti-parallel 5: A 8 9 ? anti-parallel 5: A 9 10 ? anti-parallel 5: # 5: loop_ 5: _pdbx_struct_sheet_hbond.sheet_id 5: _pdbx_struct_sheet_hbond.range_id_1 5: _pdbx_struct_sheet_hbond.range_id_2 5: _pdbx_struct_sheet_hbond.range_1_label_atom_id 5: _pdbx_struct_sheet_hbond.range_1_label_comp_id 5: _pdbx_struct_sheet_hbond.range_1_label_asym_id 5: _pdbx_struct_sheet_hbond.range_1_label_seq_id 5: _pdbx_struct_sheet_hbond.range_1_PDB_ins_code 5: _pdbx_struct_sheet_hbond.range_1_auth_atom_id 5: _pdbx_struct_sheet_hbond.range_1_auth_comp_id 5: _pdbx_struct_sheet_hbond.range_1_auth_asym_id 5: _pdbx_struct_sheet_hbond.range_1_auth_seq_id 5: _pdbx_struct_sheet_hbond.range_2_label_atom_id 5: _pdbx_struct_sheet_hbond.range_2_label_comp_id 5: _pdbx_struct_sheet_hbond.range_2_label_asym_id 5: _pdbx_struct_sheet_hbond.range_2_label_seq_id 5: _pdbx_struct_sheet_hbond.range_2_PDB_ins_code 5: _pdbx_struct_sheet_hbond.range_2_auth_atom_id 5: _pdbx_struct_sheet_hbond.range_2_auth_comp_id 5: _pdbx_struct_sheet_hbond.range_2_auth_asym_id 5: _pdbx_struct_sheet_hbond.range_2_auth_seq_id 5: A 1 2 O PHE A 65 ? O PHE A 65 N PHE A 50 ? N PHE A 50 5: A 2 3 N SER A 55 ? N SER A 55 O ALA A 40 ? O ALA A 40 5: A 3 4 N ILE A 43 ? N ILE A 43 O GLY A 5 ? O GLY A 5 5: A 4 5 N GLU A 13 ? N GLU A 13 O THR A 131 ? O THR A 131 5: A 5 6 N TYR A 134 ? N TYR A 134 O LEU A 119 ? O LEU A 119 5: A 6 7 N THR A 124 ? N THR A 124 O SER A 108 ? O SER A 108 5: A 7 8 O ARG A 111 ? O ARG A 111 N MET A 93 ? N MET A 93 5: A 8 9 O LYS A 98 ? O LYS A 98 N LYS A 82 ? N LYS A 82 5: A 9 10 N SER A 83 ? N SER A 83 O PHE A 71 ? O PHE A 71 5: # 5: Skipping validation of empty category pdbx_branch_scheme 5: data_1CBS 5: # 5: _entry.id 1CBS 5: # 5: _audit_conform.dict_name mmcif_pdbx.dic 5: _audit_conform.dict_version 5.279 5: _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 5: # 5: _struct_biol.id 1 5: _struct_biol.pdbx_parent_biol_id ? 5: # 5: loop_ 5: _entity.id 5: _entity.type 5: _entity.src_method 5: _entity.pdbx_description 5: _entity.formula_weight 5: _entity.pdbx_number_of_molecules 5: _entity.pdbx_ec 5: _entity.pdbx_mutation 5: _entity.pdbx_fragment 5: _entity.details 5: _entity.pdbx_parent_entity_id 5: 1 polymer man 'CELLULAR RETINOIC ACID BINDING PROTEIN TYPE II' 15581.802 1 ? ? ? ? ? 5: 3 water nat water 18.015 100 ? ? ? ? ? 5: 4 non-polymer ? 'RENAMED RETINOIC ACID' 300.435 1 ? ? ? ? ? 5: # 5: _symmetry.entry_id 1CBS 5: _symmetry.space_group_name_H-M 'P 21 21 21' 5: _symmetry.pdbx_full_space_group_name_H-M ? 5: _symmetry.cell_setting ? 5: _symmetry.Int_Tables_number 19 5: # 5: _struct_site.id AC1 5: _struct_site.pdbx_evidence_code Software 5: _struct_site.pdbx_auth_asym_id ? 5: _struct_site.pdbx_auth_comp_id ? 5: _struct_site.pdbx_auth_seq_id ? 5: _struct_site.pdbx_auth_ins_code ? 5: _struct_site.pdbx_num_residues 10 5: _struct_site.details 'BINDING SITE FOR RESIDUE REA A 200' 5: # 5: _struct_sheet.id A 5: _struct_sheet.type ? 5: _struct_sheet.number_strands 10 5: _struct_sheet.details ? 5: # 5: _struct_ref.id 1 5: _struct_ref.db_name UNP 5: _struct_ref.db_code RABP2_HUMAN 5: _struct_ref.entity_id 1 5: _struct_ref.pdbx_db_accession P29373 5: _struct_ref.pdbx_align_begin 1 5: _struct_ref.pdbx_seq_one_letter_code 5: ;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP 5: CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE 5: ; 5: _struct_ref.pdbx_db_isoform ? 5: _struct_ref.biol_id ? 5: # 5: _struct_keywords.entry_id 1CBS 5: _struct_keywords.pdbx_keywords 'RETINOIC-ACID TRANSPORT' 5: _struct_keywords.text 'RETINOIC-ACID TRANSPORT' 5: # 5: _struct_conf_type.id HELX_P 5: _struct_conf_type.criteria ? 5: _struct_conf_type.reference ? 5: # 5: loop_ 5: _struct_asym.id 5: _struct_asym.pdbx_blank_PDB_chainid_flag 5: _struct_asym.pdbx_modified 5: _struct_asym.entity_id 5: _struct_asym.details 5: A N N 1 ? 5: B N N 4 ? 5: C N N 3 ? 5: # 5: _struct.entry_id 1CBS 5: _struct.title 5: ;CRYSTAL STRUCTURE OF CELLULAR RETINOIC-ACID-BINDING PROTEINS I AND II IN COMPLEX WITH ALL-TRANS-RETINOIC ACID AND A SYNTHETIC RETINOID 5: ; 5: _struct.pdbx_descriptor 5: 'CELLULAR RETINOIC-ACID-BINDING PROTEIN TYPE II COMPLEXED WITH ALL-TRANS-RETINOIC ACID (THE PRESUMED PHYSIOLOGICAL LIGAND)' 5: _struct.pdbx_model_details ? 5: _struct.pdbx_CASP_flag ? 5: _struct.pdbx_model_type_details ? 5: # 5: _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' 5: _refine_hist.cycle_id LAST 5: _refine_hist.pdbx_number_atoms_protein 1091 5: _refine_hist.pdbx_number_atoms_nucleic_acid 0 5: _refine_hist.pdbx_number_atoms_ligand 22 5: _refine_hist.number_atoms_solvent 100 5: _refine_hist.number_atoms_total 1213 5: _refine_hist.d_res_high 1.8 5: _refine_hist.d_res_low 8.0 5: # 5: _refine.entry_id 1CBS 5: _refine.ls_number_reflns_obs 14312 5: _refine.ls_number_reflns_all ? 5: _refine.pdbx_ls_sigma_I ? 5: _refine.pdbx_ls_sigma_F 2. 5: _refine.pdbx_data_cutoff_high_absF ? 5: _refine.pdbx_data_cutoff_low_absF ? 5: _refine.pdbx_data_cutoff_high_rms_absF ? 5: _refine.ls_d_res_low 8.0 5: _refine.ls_d_res_high 1.8 5: _refine.ls_percent_reflns_obs 90.3 5: _refine.ls_R_factor_obs 0.2000000 5: _refine.ls_R_factor_all ? 5: _refine.ls_R_factor_R_work 0.2000000 5: _refine.ls_R_factor_R_free 0.2370000 5: _refine.ls_R_factor_R_free_error ? 5: _refine.ls_R_factor_R_free_error_details ? 5: _refine.ls_percent_reflns_R_free ? 5: _refine.ls_number_reflns_R_free ? 5: _refine.ls_number_parameters ? 5: _refine.ls_number_restraints ? 5: _refine.occupancy_min ? 5: _refine.occupancy_max ? 5: _refine.B_iso_mean 16.6 5: _refine.aniso_B[1][1] ? 5: _refine.aniso_B[2][2] ? 5: _refine.aniso_B[3][3] ? 5: _refine.aniso_B[1][2] ? 5: _refine.aniso_B[1][3] ? 5: _refine.aniso_B[2][3] ? 5: _refine.solvent_model_details ? 5: _refine.solvent_model_param_ksol ? 5: _refine.solvent_model_param_bsol ? 5: _refine.pdbx_ls_cross_valid_method ? 5: _refine.details ? 5: _refine.pdbx_starting_model ? 5: _refine.pdbx_method_to_determine_struct ? 5: _refine.pdbx_isotropic_thermal_model ? 5: _refine.pdbx_stereochemistry_target_values ? 5: _refine.pdbx_stereochem_target_val_spec_case ? 5: _refine.pdbx_R_Free_selection_details ? 5: _refine.pdbx_overall_ESU_R ? 5: _refine.pdbx_overall_ESU_R_Free ? 5: _refine.overall_SU_ML ? 5: _refine.overall_SU_B ? 5: _refine.pdbx_refine_id 'X-RAY DIFFRACTION' 5: _refine.pdbx_diffrn_id 1 5: _refine.pdbx_TLS_residual_ADP_flag ? 5: _refine.correlation_coeff_Fo_to_Fc ? 5: _refine.correlation_coeff_Fo_to_Fc_free ? 5: _refine.pdbx_solvent_vdw_probe_radii ? 5: _refine.pdbx_solvent_ion_probe_radii ? 5: _refine.pdbx_solvent_shrinkage_radii ? 5: _refine.pdbx_overall_phase_error ? 5: _refine.overall_SU_R_Cruickshank_DPI ? 5: _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? 5: _refine.pdbx_overall_SU_R_Blow_DPI ? 5: _refine.pdbx_overall_SU_R_free_Blow_DPI ? 5: # 5: _pdbx_struct_oper_list.id 1 5: _pdbx_struct_oper_list.type 'identity operation' 5: _pdbx_struct_oper_list.name 1_555 5: _pdbx_struct_oper_list.symmetry_operation x,y,z 5: _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 5: _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 5: _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 5: _pdbx_struct_oper_list.vector[1] 0.0000000000 5: _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 5: _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 5: _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 5: _pdbx_struct_oper_list.vector[2] 0.0000000000 5: _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 5: _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 5: _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 5: _pdbx_struct_oper_list.vector[3] 0.0000000000 5: # 5: _pdbx_struct_assembly.id 1 5: _pdbx_struct_assembly.details author_defined_assembly 5: _pdbx_struct_assembly.method_details ? 5: _pdbx_struct_assembly.oligomeric_details monomeric 5: _pdbx_struct_assembly.oligomeric_count 1 5: # 5: _pdbx_database_status.status_code REL 5: _pdbx_database_status.entry_id 1CBS 5: _pdbx_database_status.recvd_initial_deposition_date 1994-09-28 5: _pdbx_database_status.deposit_site ? 5: _pdbx_database_status.process_site ? 5: _pdbx_database_status.status_code_sf REL 5: _pdbx_database_status.status_code_mr ? 5: _pdbx_database_status.SG_entry ? 5: _pdbx_database_status.pdb_format_compatible Y 5: _pdbx_database_status.status_code_cs ? 5: # 5: loop_ 5: _pdbx_audit_revision_history.ordinal 5: _pdbx_audit_revision_history.data_content_type 5: _pdbx_audit_revision_history.major_revision 5: _pdbx_audit_revision_history.minor_revision 5: _pdbx_audit_revision_history.revision_date 5: 1 'Structure model' 1 0 1995-01-26 5: 2 'Structure model' 1 1 2008-03-24 5: 3 'Structure model' 1 2 2011-07-13 5: # 5: _exptl_crystal.id 1 5: _exptl_crystal.density_meas ? 5: _exptl_crystal.density_Matthews 2.70 5: _exptl_crystal.density_percent_sol 54.49 5: _exptl_crystal.description ? 5: # 5: _exptl.entry_id 1CBS 5: _exptl.method 'X-RAY DIFFRACTION' 5: _exptl.crystals_number ? 5: # 5: _entity_src_gen.entity_id 1 5: _entity_src_gen.pdbx_src_id 1 5: _entity_src_gen.pdbx_alt_source_flag sample 5: _entity_src_gen.pdbx_seq_type ? 5: _entity_src_gen.pdbx_beg_seq_num ? 5: _entity_src_gen.pdbx_end_seq_num ? 5: _entity_src_gen.gene_src_common_name human 5: _entity_src_gen.gene_src_genus Homo 5: _entity_src_gen.pdbx_gene_src_gene 'HUMAN CRABP-II' 5: _entity_src_gen.gene_src_species ? 5: _entity_src_gen.gene_src_strain ? 5: _entity_src_gen.gene_src_tissue ? 5: _entity_src_gen.gene_src_tissue_fraction ? 5: _entity_src_gen.gene_src_details ? 5: _entity_src_gen.pdbx_gene_src_fragment ? 5: _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' 5: _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 5: _entity_src_gen.pdbx_gene_src_variant ? 5: _entity_src_gen.pdbx_gene_src_cell_line BL21 5: _entity_src_gen.pdbx_gene_src_atcc ? 5: _entity_src_gen.pdbx_gene_src_organ ? 5: _entity_src_gen.pdbx_gene_src_organelle ? 5: _entity_src_gen.pdbx_gene_src_cell ? 5: _entity_src_gen.pdbx_gene_src_cellular_location ? 5: _entity_src_gen.host_org_common_name ? 5: _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' 5: _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 5: _entity_src_gen.host_org_genus Escherichia 5: _entity_src_gen.pdbx_host_org_gene ? 5: _entity_src_gen.pdbx_host_org_organ ? 5: _entity_src_gen.host_org_species 'Escherichia coli' 5: _entity_src_gen.pdbx_host_org_tissue ? 5: _entity_src_gen.pdbx_host_org_tissue_fraction ? 5: _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' 5: _entity_src_gen.pdbx_host_org_variant ? 5: _entity_src_gen.pdbx_host_org_cell_line ? 5: _entity_src_gen.pdbx_host_org_atcc ? 5: _entity_src_gen.pdbx_host_org_culture_collection ? 5: _entity_src_gen.pdbx_host_org_cell ? 5: _entity_src_gen.pdbx_host_org_organelle ? 5: _entity_src_gen.pdbx_host_org_cellular_location ? 5: _entity_src_gen.pdbx_host_org_vector_type ? 5: _entity_src_gen.pdbx_host_org_vector ? 5: _entity_src_gen.host_org_details ? 5: _entity_src_gen.expression_system_id ? 5: _entity_src_gen.plasmid_name PET-3A 5: _entity_src_gen.plasmid_details ? 5: _entity_src_gen.pdbx_description ? 5: # 5: _entity_poly.entity_id 1 5: _entity_poly.type polypeptide(L) 5: _entity_poly.nstd_linkage no 5: _entity_poly.nstd_monomer no 5: _entity_poly.pdbx_seq_one_letter_code 5: ;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP 5: CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE 5: ; 5: _entity_poly.pdbx_seq_one_letter_code_can 5: ;PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRP 5: CKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE 5: ; 5: _entity_poly.pdbx_strand_id A 5: _entity_poly.pdbx_target_identifier ? 5: # 5: _diffrn_radiation_wavelength.id 1 5: _diffrn_radiation_wavelength.wavelength . 5: _diffrn_radiation_wavelength.wt 1.0 5: # 5: _database_PDB_matrix.entry_id 1CBS 5: _database_PDB_matrix.origx[1][1] 1.000000 5: _database_PDB_matrix.origx[1][2] 0.000000 5: _database_PDB_matrix.origx[1][3] 0.000000 5: _database_PDB_matrix.origx[2][1] 0.000000 5: _database_PDB_matrix.origx[2][2] 1.000000 5: _database_PDB_matrix.origx[2][3] 0.000000 5: _database_PDB_matrix.origx[3][1] 0.000000 5: _database_PDB_matrix.origx[3][2] 0.000000 5: _database_PDB_matrix.origx[3][3] 1.000000 5: _database_PDB_matrix.origx_vector[1] 0.00000 5: _database_PDB_matrix.origx_vector[2] 0.00000 5: _database_PDB_matrix.origx_vector[3] 0.00000 5: # 5: loop_ 5: _database_2.database_id 5: _database_2.database_code 5: PDB 1CBS 5: WWPDB D_1000172215 5: # 5: loop_ 5: _citation.id 5: _citation.title 5: _citation.journal_abbrev 5: _citation.journal_volume 5: _citation.page_first 5: _citation.page_last 5: _citation.year 5: _citation.journal_id_ASTM 5: _citation.country 5: _citation.journal_id_ISSN 5: _citation.journal_id_CSD 5: _citation.book_publisher 5: _citation.pdbx_database_id_PubMed 5: _citation.pdbx_database_id_DOI 5: primary 5: ;Crystal structures of cellular retinoic acid binding proteins I and II in complex with all-trans-retinoic acid and a synthetic retinoid. 5: ; 5: Structure 2 1241 1258 1994 STRUE6 UK 0969-2126 2005 ? 7704533 10.1016/S0969-2126(94)00125-1 5: 1 'Lipid-Binding Proteins: A Family of Fatty Acid and Retinoid Transport Proteins' 5: 'Adv.Protein Chem.' 45 89 ? 1994 APCHA2 US 0065-3233 0433 ? ? ? 5: 2 'Crystallisation and Preliminary X-Ray Analysis of Recombinant Bovine Cellular Retinoic Acid-Binding Protein' 5: 'Acta Crystallogr.,Sect.D' 50 370 ? 1994 ABCRE6 DK 0907-4449 0766 ? ? ? 5: 3 5: ;Crystallographic Studies on a Family of Lipophilic Transport Proteins. Refinement of P2 Myelin Protein and the Structure Determination and Refinement of Cellular Retinol-Binding Protein in Complex with All-Trans-Retinol 5: ; 5: J.Mol.Biol. 230 1225 ? 1993 JMOBAK UK 0022-2836 0070 ? ? ? 5: 4 'The Three-Dimensional Structure of P2 Myelin Protein' 5: 'Embo J.' 7 1597 ? 1988 EMJODG UK 0261-4189 0897 ? ? ? 5: # 5: loop_ 5: _chem_comp.id 5: _chem_comp.type 5: _chem_comp.mon_nstd_flag 5: _chem_comp.name 5: _chem_comp.pdbx_synonyms 5: _chem_comp.formula 5: _chem_comp.formula_weight 5: ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 5: ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 5: ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 5: ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 5: CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 5: GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 5: GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 5: GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 5: HOH non-polymer . WATER ? 'H2 O' 18.015 5: ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 5: LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 5: LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 5: MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 5: PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 5: PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 5: SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 5: THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 5: TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 5: TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 5: VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 5: RXA NON-POLYMER ? 'RENAMED RETINOIC ACID' ? 'C20 H28 O2' 300.435 5: # 5: _cell.entry_id 1CBS 5: _cell.length_a 45.650 5: _cell.length_b 47.560 5: _cell.length_c 77.610 5: _cell.angle_alpha 90.00 5: _cell.angle_beta 90.00 5: _cell.angle_gamma 90.00 5: _cell.Z_PDB 4 5: _cell.pdbx_unique_axis ? 5: # 5: loop_ 5: _audit_author.name 5: _audit_author.pdbx_ordinal 5: 'Kleywegt, G.J.' 1 5: 'Bergfors, T.' 2 5: 'Jones, T.A.' 3 5: # 5: loop_ 5: _atom_type.symbol 5: C 5: N 5: O 5: S 5: # 5: _atom_sites.entry_id 1CBS 5: _atom_sites.fract_transf_matrix[1][1] 0.021906 5: _atom_sites.fract_transf_matrix[1][2] 0.000000 5: _atom_sites.fract_transf_matrix[1][3] 0.000000 5: _atom_sites.fract_transf_matrix[2][1] 0.000000 5: _atom_sites.fract_transf_matrix[2][2] 0.021026 5: _atom_sites.fract_transf_matrix[2][3] 0.000000 5: _atom_sites.fract_transf_matrix[3][1] 0.000000 5: _atom_sites.fract_transf_matrix[3][2] 0.000000 5: _atom_sites.fract_transf_matrix[3][3] 0.012885 5: _atom_sites.fract_transf_vector[1] 0.00000 5: _atom_sites.fract_transf_vector[2] 0.00000 5: _atom_sites.fract_transf_vector[3] 0.00000 5: # 5: loop_ 5: _software.name 5: _software.classification 5: _software.version 5: _software.citation_id 5: _software.pdbx_ordinal 5: X-PLOR 'model building' . ? 1 5: X-PLOR refinement . ? 2 5: X-PLOR phasing . ? 3 5: # 5: loop_ 5: _refine_ls_restr.type 5: _refine_ls_restr.dev_ideal 5: _refine_ls_restr.dev_ideal_target 5: _refine_ls_restr.weight 5: _refine_ls_restr.number 5: _refine_ls_restr.pdbx_refine_id 5: _refine_ls_restr.pdbx_restraint_function 5: x_bond_d 0.010 ? ? ? 'X-RAY DIFFRACTION' ? 5: x_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_angle_deg 1.51 ? ? ? 'X-RAY DIFFRACTION' ? 5: x_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_dihedral_angle_d 27.4 ? ? ? 'X-RAY DIFFRACTION' ? 5: x_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_improper_angle_d 1.32 ? ? ? 'X-RAY DIFFRACTION' ? 5: x_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? 5: x_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? 5: # 5: _refine_analyze.entry_id 1CBS 5: _refine_analyze.Luzzati_coordinate_error_obs 0.2 5: _refine_analyze.Luzzati_sigma_a_obs ? 5: _refine_analyze.Luzzati_d_res_low_obs ? 5: _refine_analyze.Luzzati_coordinate_error_free ? 5: _refine_analyze.Luzzati_sigma_a_free ? 5: _refine_analyze.Luzzati_d_res_low_free ? 5: _refine_analyze.number_disordered_residues ? 5: _refine_analyze.occupancy_sum_hydrogen ? 5: _refine_analyze.occupancy_sum_non_hydrogen ? 5: _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' 5: # 5: _pdbx_struct_assembly_gen.assembly_id 1 5: _pdbx_struct_assembly_gen.oper_expression 1 5: _pdbx_struct_assembly_gen.asym_id_list A,B,C 5: # 5: loop_ 5: _pdbx_audit_revision_group.ordinal 5: _pdbx_audit_revision_group.revision_ordinal 5: _pdbx_audit_revision_group.data_content_type 5: _pdbx_audit_revision_group.group 5: 1 2 'Structure model' 'Version format compliance' 5: 2 3 'Structure model' 'Version format compliance' 5: # 5: _pdbx_audit_revision_details.ordinal 1 5: _pdbx_audit_revision_details.revision_ordinal 1 5: _pdbx_audit_revision_details.data_content_type 'Structure model' 5: _pdbx_audit_revision_details.provider repository 5: _pdbx_audit_revision_details.type 'Initial release' 5: _pdbx_audit_revision_details.description ? 5: # 5: _diffrn.id 1 5: _diffrn.ambient_temp ? 5: _diffrn.ambient_temp_details ? 5: _diffrn.crystal_id 1 5: # 5: loop_ 5: _citation_author.citation_id 5: _citation_author.name 5: _citation_author.ordinal 5: primary 'Kleywegt, G.J.' 1 5: primary 'Bergfors, T.' 2 5: primary 'Senn, H.' 3 5: primary 'Le Motte, P.' 4 5: primary 'Gsell, B.' 5 5: primary 'Shudo, K.' 6 5: primary 'Jones, T.A.' 7 5: 1 'Banaszak, L.' 8 5: 1 'Winter, N.' 9 5: 1 'Xu, Z.' 10 5: 1 'Bernlohr, D.A.' 11 5: 1 'Cowan, S.W.' 12 5: 1 'Jones, T.A.' 13 5: 2 'Bergfors, T.' 14 5: 2 'Kleywegt, G.J.' 15 5: 2 'Jones, T.A.' 16 5: 3 'Cowan, S.W.' 17 5: 3 'Newcomer, M.E.' 18 5: 3 'Jones, T.A.' 19 5: 4 'Jones, T.A.' 20 5: 4 'Bergfors, T.' 21 5: 4 'Sedzik, J.' 22 5: 4 'Unge, T.' 23 5: # 5: _reflns.entry_id 1CBS 5: _reflns.observed_criterion_sigma_I 3. 5: _reflns.observed_criterion_sigma_F ? 5: _reflns.d_resolution_low ? 5: _reflns.d_resolution_high ? 5: _reflns.number_obs 14678 5: _reflns.number_all ? 5: _reflns.percent_possible_obs 90.3 5: _reflns.pdbx_Rmerge_I_obs ? 5: _reflns.pdbx_Rsym_value ? 5: _reflns.pdbx_netI_over_sigmaI ? 5: _reflns.B_iso_Wilson_estimate ? 5: _reflns.pdbx_redundancy ? 5: _reflns.pdbx_diffrn_id 1 5: _reflns.pdbx_ordinal 1 5: _reflns.pdbx_signal_software_id ? 5: # 5: loop_ 5: _entity_poly_seq.entity_id 5: _entity_poly_seq.num 5: _entity_poly_seq.mon_id 5: _entity_poly_seq.hetero 5: 1 1 PRO n 5: 1 2 ASN n 5: 1 3 PHE n 5: 1 4 SER n 5: 1 5 GLY n 5: 1 6 ASN n 5: 1 7 TRP n 5: 1 8 LYS n 5: 1 9 ILE n 5: 1 10 ILE n 5: 1 11 ARG n 5: 1 12 SER n 5: 1 13 GLU n 5: 1 14 ASN n 5: 1 15 PHE n 5: 1 16 GLU n 5: 1 17 GLU n 5: 1 18 LEU n 5: 1 19 LEU n 5: 1 20 LYS n 5: 1 21 VAL n 5: 1 22 LEU n 5: 1 23 GLY n 5: 1 24 VAL n 5: 1 25 ASN n 5: 1 26 VAL n 5: 1 27 MET n 5: 1 28 LEU n 5: 1 29 ARG n 5: 1 30 LYS n 5: 1 31 ILE n 5: 1 32 ALA n 5: 1 33 VAL n 5: 1 34 ALA n 5: 1 35 ALA n 5: 1 36 ALA n 5: 1 37 SER n 5: 1 38 LYS n 5: 1 39 PRO n 5: 1 40 ALA n 5: 1 41 VAL n 5: 1 42 GLU n 5: 1 43 ILE n 5: 1 44 LYS n 5: 1 45 GLN n 5: 1 46 GLU n 5: 1 47 GLY n 5: 1 48 ASP n 5: 1 49 THR n 5: 1 50 PHE n 5: 1 51 TYR n 5: 1 52 ILE n 5: 1 53 LYS n 5: 1 54 THR n 5: 1 55 SER n 5: 1 56 THR n 5: 1 57 THR n 5: 1 58 VAL n 5: 1 59 ARG n 5: 1 60 THR n 5: 1 61 THR n 5: 1 62 GLU n 5: 1 63 ILE n 5: 1 64 ASN n 5: 1 65 PHE n 5: 1 66 LYS n 5: 1 67 VAL n 5: 1 68 GLY n 5: 1 69 GLU n 5: 1 70 GLU n 5: 1 71 PHE n 5: 1 72 GLU n 5: 1 73 GLU n 5: 1 74 GLN n 5: 1 75 THR n 5: 1 76 VAL n 5: 1 77 ASP n 5: 1 78 GLY n 5: 1 79 ARG n 5: 1 80 PRO n 5: 1 81 CYS n 5: 1 82 LYS n 5: 1 83 SER n 5: 1 84 LEU n 5: 1 85 VAL n 5: 1 86 LYS n 5: 1 87 TRP n 5: 1 88 GLU n 5: 1 89 SER n 5: 1 90 GLU n 5: 1 91 ASN n 5: 1 92 LYS n 5: 1 93 MET n 5: 1 94 VAL n 5: 1 95 CYS n 5: 1 96 GLU n 5: 1 97 GLN n 5: 1 98 LYS n 5: 1 99 LEU n 5: 1 100 LEU n 5: 1 101 LYS n 5: 1 102 GLY n 5: 1 103 GLU n 5: 1 104 GLY n 5: 1 105 PRO n 5: 1 106 LYS n 5: 1 107 THR n 5: 1 108 SER n 5: 1 109 TRP n 5: 1 110 THR n 5: 1 111 ARG n 5: 1 112 GLU n 5: 1 113 LEU n 5: 1 114 THR n 5: 1 115 ASN n 5: 1 116 ASP n 5: 1 117 GLY n 5: 1 118 GLU n 5: 1 119 LEU n 5: 1 120 ILE n 5: 1 121 LEU n 5: 1 122 THR n 5: 1 123 MET n 5: 1 124 THR n 5: 1 125 ALA n 5: 1 126 ASP n 5: 1 127 ASP n 5: 1 128 VAL n 5: 1 129 VAL n 5: 1 130 CYS n 5: 1 131 THR n 5: 1 132 ARG n 5: 1 133 VAL n 5: 1 134 TYR n 5: 1 135 VAL n 5: 1 136 ARG n 5: 1 137 GLU n 5: # 5: _diffrn_radiation.diffrn_id 1 5: _diffrn_radiation.wavelength_id 1 5: _diffrn_radiation.pdbx_monochromatic_or_laue_m_l ? 5: _diffrn_radiation.monochromator ? 5: _diffrn_radiation.pdbx_diffrn_protocol ? 5: _diffrn_radiation.pdbx_scattering_type x-ray 5: # 5: loop_ 5: _pdbx_poly_seq_scheme.asym_id 5: _pdbx_poly_seq_scheme.entity_id 5: _pdbx_poly_seq_scheme.seq_id 5: _pdbx_poly_seq_scheme.mon_id 5: _pdbx_poly_seq_scheme.ndb_seq_num 5: _pdbx_poly_seq_scheme.pdb_seq_num 5: _pdbx_poly_seq_scheme.auth_seq_num 5: _pdbx_poly_seq_scheme.pdb_mon_id 5: _pdbx_poly_seq_scheme.auth_mon_id 5: _pdbx_poly_seq_scheme.pdb_strand_id 5: _pdbx_poly_seq_scheme.pdb_ins_code 5: _pdbx_poly_seq_scheme.hetero 5: A 1 1 PRO 1 1 1 PRO PRO A . n 5: A 1 2 ASN 2 2 2 ASN ASN A . n 5: A 1 3 PHE 3 3 3 PHE PHE A . n 5: A 1 4 SER 4 4 4 SER SER A . n 5: A 1 5 GLY 5 5 5 GLY GLY A . n 5: A 1 6 ASN 6 6 6 ASN ASN A . n 5: A 1 7 TRP 7 7 7 TRP TRP A . n 5: A 1 8 LYS 8 8 8 LYS LYS A . n 5: A 1 9 ILE 9 9 9 ILE ILE A . n 5: A 1 10 ILE 10 10 10 ILE ILE A . n 5: A 1 11 ARG 11 11 11 ARG ARG A . n 5: A 1 12 SER 12 12 12 SER SER A . n 5: A 1 13 GLU 13 13 13 GLU GLU A . n 5: A 1 14 ASN 14 14 14 ASN ASN A . n 5: A 1 15 PHE 15 15 15 PHE PHE A . n 5: A 1 16 GLU 16 16 16 GLU GLU A . n 5: A 1 17 GLU 17 17 17 GLU GLU A . n 5: A 1 18 LEU 18 18 18 LEU LEU A . n 5: A 1 19 LEU 19 19 19 LEU LEU A . n 5: A 1 20 LYS 20 20 20 LYS LYS A . n 5: A 1 21 VAL 21 21 21 VAL VAL A . n 5: A 1 22 LEU 22 22 22 LEU LEU A . n 5: A 1 23 GLY 23 23 23 GLY GLY A . n 5: A 1 24 VAL 24 24 24 VAL VAL A . n 5: A 1 25 ASN 25 25 25 ASN ASN A . n 5: A 1 26 VAL 26 26 26 VAL VAL A . n 5: A 1 27 MET 27 27 27 MET MET A . n 5: A 1 28 LEU 28 28 28 LEU LEU A . n 5: A 1 29 ARG 29 29 29 ARG ARG A . n 5: A 1 30 LYS 30 30 30 LYS LYS A . n 5: A 1 31 ILE 31 31 31 ILE ILE A . n 5: A 1 32 ALA 32 32 32 ALA ALA A . n 5: A 1 33 VAL 33 33 33 VAL VAL A . n 5: A 1 34 ALA 34 34 34 ALA ALA A . n 5: A 1 35 ALA 35 35 35 ALA ALA A . n 5: A 1 36 ALA 36 36 36 ALA ALA A . n 5: A 1 37 SER 37 37 37 SER SER A . n 5: A 1 38 LYS 38 38 38 LYS LYS A . n 5: A 1 39 PRO 39 39 39 PRO PRO A . n 5: A 1 40 ALA 40 40 40 ALA ALA A . n 5: A 1 41 VAL 41 41 41 VAL VAL A . n 5: A 1 42 GLU 42 42 42 GLU GLU A . n 5: A 1 43 ILE 43 43 43 ILE ILE A . n 5: A 1 44 LYS 44 44 44 LYS LYS A . n 5: A 1 45 GLN 45 45 45 GLN GLN A . n 5: A 1 46 GLU 46 46 46 GLU GLU A . n 5: A 1 47 GLY 47 47 47 GLY GLY A . n 5: A 1 48 ASP 48 48 48 ASP ASP A . n 5: A 1 49 THR 49 49 49 THR THR A . n 5: A 1 50 PHE 50 50 50 PHE PHE A . n 5: A 1 51 TYR 51 51 51 TYR TYR A . n 5: A 1 52 ILE 52 52 52 ILE ILE A . n 5: A 1 53 LYS 53 53 53 LYS LYS A . n 5: A 1 54 THR 54 54 54 THR THR A . n 5: A 1 55 SER 55 55 55 SER SER A . n 5: A 1 56 THR 56 56 56 THR THR A . n 5: A 1 57 THR 57 57 57 THR THR A . n 5: A 1 58 VAL 58 58 58 VAL VAL A . n 5: A 1 59 ARG 59 59 59 ARG ARG A . n 5: A 1 60 THR 60 60 60 THR THR A . n 5: A 1 61 THR 61 61 61 THR THR A . n 5: A 1 62 GLU 62 62 62 GLU GLU A . n 5: A 1 63 ILE 63 63 63 ILE ILE A . n 5: A 1 64 ASN 64 64 64 ASN ASN A . n 5: A 1 65 PHE 65 65 65 PHE PHE A . n 5: A 1 66 LYS 66 66 66 LYS LYS A . n 5: A 1 67 VAL 67 67 67 VAL VAL A . n 5: A 1 68 GLY 68 68 68 GLY GLY A . n 5: A 1 69 GLU 69 69 69 GLU GLU A . n 5: A 1 70 GLU 70 70 70 GLU GLU A . n 5: A 1 71 PHE 71 71 71 PHE PHE A . n 5: A 1 72 GLU 72 72 72 GLU GLU A . n 5: A 1 73 GLU 73 73 73 GLU GLU A . n 5: A 1 74 GLN 74 74 74 GLN GLN A . n 5: A 1 75 THR 75 75 75 THR THR A . n 5: A 1 76 VAL 76 76 76 VAL VAL A . n 5: A 1 77 ASP 77 77 77 ASP ASP A . n 5: A 1 78 GLY 78 78 78 GLY GLY A . n 5: A 1 79 ARG 79 79 79 ARG ARG A . n 5: A 1 80 PRO 80 80 80 PRO PRO A . n 5: A 1 81 CYS 81 81 81 CYS CYS A . n 5: A 1 82 LYS 82 82 82 LYS LYS A . n 5: A 1 83 SER 83 83 83 SER SER A . n 5: A 1 84 LEU 84 84 84 LEU LEU A . n 5: A 1 85 VAL 85 85 85 VAL VAL A . n 5: A 1 86 LYS 86 86 86 LYS LYS A . n 5: A 1 87 TRP 87 87 87 TRP TRP A . n 5: A 1 88 GLU 88 88 88 GLU GLU A . n 5: A 1 89 SER 89 89 89 SER SER A . n 5: A 1 90 GLU 90 90 90 GLU GLU A . n 5: A 1 91 ASN 91 91 91 ASN ASN A . n 5: A 1 92 LYS 92 92 92 LYS LYS A . n 5: A 1 93 MET 93 93 93 MET MET A . n 5: A 1 94 VAL 94 94 94 VAL VAL A . n 5: A 1 95 CYS 95 95 95 CYS CYS A . n 5: A 1 96 GLU 96 96 96 GLU GLU A . n 5: A 1 97 GLN 97 97 97 GLN GLN A . n 5: A 1 98 LYS 98 98 98 LYS LYS A . n 5: A 1 99 LEU 99 99 99 LEU LEU A . n 5: A 1 100 LEU 100 100 100 LEU LEU A . n 5: A 1 101 LYS 101 101 101 LYS LYS A . n 5: A 1 102 GLY 102 102 102 GLY GLY A . n 5: A 1 103 GLU 103 103 103 GLU GLU A . n 5: A 1 104 GLY 104 104 104 GLY GLY A . n 5: A 1 105 PRO 105 105 105 PRO PRO A . n 5: A 1 106 LYS 106 106 106 LYS LYS A . n 5: A 1 107 THR 107 107 107 THR THR A . n 5: A 1 108 SER 108 108 108 SER SER A . n 5: A 1 109 TRP 109 109 109 TRP TRP A . n 5: A 1 110 THR 110 110 110 THR THR A . n 5: A 1 111 ARG 111 111 111 ARG ARG A . n 5: A 1 112 GLU 112 112 112 GLU GLU A . n 5: A 1 113 LEU 113 113 113 LEU LEU A . n 5: A 1 114 THR 114 114 114 THR THR A . n 5: A 1 115 ASN 115 115 115 ASN ASN A . n 5: A 1 116 ASP 116 116 116 ASP ASP A . n 5: A 1 117 GLY 117 117 117 GLY GLY A . n 5: A 1 118 GLU 118 118 118 GLU GLU A . n 5: A 1 119 LEU 119 119 119 LEU LEU A . n 5: A 1 120 ILE 120 120 120 ILE ILE A . n 5: A 1 121 LEU 121 121 121 LEU LEU A . n 5: A 1 122 THR 122 122 122 THR THR A . n 5: A 1 123 MET 123 123 123 MET MET A . n 5: A 1 124 THR 124 124 124 THR THR A . n 5: A 1 125 ALA 125 125 125 ALA ALA A . n 5: A 1 126 ASP 126 126 126 ASP ASP A . n 5: A 1 127 ASP 127 127 127 ASP ASP A . n 5: A 1 128 VAL 128 128 128 VAL VAL A . n 5: A 1 129 VAL 129 129 129 VAL VAL A . n 5: A 1 130 CYS 130 130 130 CYS CYS A . n 5: A 1 131 THR 131 131 131 THR THR A . n 5: A 1 132 ARG 132 132 132 ARG ARG A . n 5: A 1 133 VAL 133 133 133 VAL VAL A . n 5: A 1 134 TYR 134 134 134 TYR TYR A . n 5: A 1 135 VAL 135 135 135 VAL VAL A . n 5: A 1 136 ARG 136 136 136 ARG ARG A . n 5: A 1 137 GLU 137 137 137 GLU GLU A . n 5: # 5: loop_ 5: _atom_site.group_PDB 5: _atom_site.id 5: _atom_site.type_symbol 5: _atom_site.label_atom_id 5: _atom_site.label_alt_id 5: _atom_site.label_comp_id 5: _atom_site.label_asym_id 5: _atom_site.label_entity_id 5: _atom_site.label_seq_id 5: _atom_site.pdbx_PDB_ins_code 5: _atom_site.Cartn_x 5: _atom_site.Cartn_y 5: _atom_site.Cartn_z 5: _atom_site.occupancy 5: _atom_site.B_iso_or_equiv 5: _atom_site.pdbx_formal_charge 5: _atom_site.auth_seq_id 5: _atom_site.auth_comp_id 5: _atom_site.auth_asym_id 5: _atom_site.auth_atom_id 5: _atom_site.pdbx_PDB_model_num 5: ATOM 1 N N . PRO A 1 1 ? 16.979 13.301 44.555 1.00 30.05 ? 1 PRO A N 1 5: ATOM 2 C CA . PRO A 1 1 ? 18.150 13.525 43.680 1.00 28.82 ? 1 PRO A CA 1 5: ATOM 3 C C . PRO A 1 1 ? 18.656 14.966 43.784 1.00 26.59 ? 1 PRO A C 1 5: ATOM 4 O O . PRO A 1 1 ? 17.890 15.889 44.078 1.00 26.84 ? 1 PRO A O 1 5: ATOM 5 C CB . PRO A 1 1 ? 17.678 13.270 42.255 1.00 29.24 ? 1 PRO A CB 1 5: ATOM 6 C CG . PRO A 1 1 ? 16.248 13.734 42.347 1.00 29.29 ? 1 PRO A CG 1 5: ATOM 7 C CD . PRO A 1 1 ? 15.762 13.216 43.724 1.00 30.71 ? 1 PRO A CD 1 5: ATOM 8 N N . ASN A 1 2 ? 19.957 15.139 43.558 1.00 24.04 ? 2 ASN A N 1 5: ATOM 9 C CA . ASN A 1 2 ? 20.576 16.457 43.578 1.00 20.79 ? 2 ASN A CA 1 5: ATOM 10 C C . ASN A 1 2 ? 21.301 16.714 42.262 1.00 16.75 ? 2 ASN A C 1 5: ATOM 11 O O . ASN A 1 2 ? 22.402 16.215 42.028 1.00 15.23 ? 2 ASN A O 1 5: ATOM 12 C CB . ASN A 1 2 ? 21.559 16.620 44.724 1.00 22.81 ? 2 ASN A CB 1 5: ATOM 13 C CG . ASN A 1 2 ? 22.240 17.968 44.685 1.00 24.29 ? 2 ASN A CG 1 5: ATOM 14 O OD1 . ASN A 1 2 ? 21.612 18.984 44.358 1.00 21.87 ? 2 ASN A OD1 1 5: ATOM 15 N ND2 . ASN A 1 2 ? 23.537 17.983 44.966 1.00 27.94 ? 2 ASN A ND2 1 5: ATOM 16 N N . PHE A 1 3 ? 20.637 17.477 41.402 1.00 14.69 ? 3 PHE A N 1 5: ATOM 17 C CA . PHE A 1 3 ? 21.144 17.838 40.087 1.00 12.62 ? 3 PHE A CA 1 5: ATOM 18 C C . PHE A 1 3 ? 22.152 18.987 40.140 1.00 12.43 ? 3 PHE A C 1 5: ATOM 19 O O . PHE A 1 3 ? 22.796 19.289 39.136 1.00 12.12 ? 3 PHE A O 1 5: ATOM 20 C CB . PHE A 1 3 ? 19.970 18.262 39.188 1.00 10.74 ? 3 PHE A CB 1 5: ATOM 21 C CG . PHE A 1 3 ? 19.073 17.128 38.750 1.00 11.85 ? 3 PHE A CG 1 5: ATOM 22 C CD1 . PHE A 1 3 ? 18.066 16.646 39.581 1.00 10.90 ? 3 PHE A CD1 1 5: ATOM 23 C CD2 . PHE A 1 3 ? 19.189 16.588 37.475 1.00 13.26 ? 3 PHE A CD2 1 5: ATOM 24 C CE1 . PHE A 1 3 ? 17.200 15.662 39.149 1.00 9.12 ? 3 PHE A CE1 1 5: ATOM 25 C CE2 . PHE A 1 3 ? 18.312 15.594 37.041 1.00 11.76 ? 3 PHE A CE2 1 5: ATOM 26 C CZ . PHE A 1 3 ? 17.324 15.137 37.878 1.00 10.30 ? 3 PHE A CZ 1 5: ATOM 27 N N . SER A 1 4 ? 22.282 19.630 41.299 1.00 11.24 ? 4 SER A N 1 5: ATOM 28 C CA . SER A 1 4 ? 23.170 20.780 41.464 1.00 11.30 ? 4 SER A CA 1 5: ATOM 29 C C . SER A 1 4 ? 24.627 20.568 41.091 1.00 10.39 ? 4 SER A C 1 5: ATOM 30 O O . SER A 1 4 ? 25.201 19.532 41.384 1.00 10.24 ? 4 SER A O 1 5: ATOM 31 C CB . SER A 1 4 ? 23.112 21.301 42.906 1.00 13.53 ? 4 SER A CB 1 5: ATOM 32 O OG . SER A 1 4 ? 21.821 21.787 43.240 1.00 16.76 ? 4 SER A OG 1 5: ATOM 33 N N . GLY A 1 5 ? 25.224 21.572 40.460 1.00 9.87 ? 5 GLY A N 1 5: ATOM 34 C CA . GLY A 1 5 ? 26.628 21.486 40.103 1.00 10.86 ? 5 GLY A CA 1 5: ATOM 35 C C . GLY A 1 5 ? 26.985 22.158 38.794 1.00 11.21 ? 5 GLY A C 1 5: ATOM 36 O O . GLY A 1 5 ? 26.123 22.761 38.142 1.00 9.91 ? 5 GLY A O 1 5: ATOM 37 N N . ASN A 1 6 ? 28.277 22.142 38.475 1.00 10.41 ? 6 ASN A N 1 5: ATOM 38 C CA . ASN A 1 6 ? 28.796 22.676 37.211 1.00 11.06 ? 6 ASN A CA 1 5: ATOM 39 C C . ASN A 1 6 ? 29.117 21.435 36.378 1.00 10.33 ? 6 ASN A C 1 5: ATOM 40 O O . ASN A 1 6 ? 29.947 20.603 36.754 1.00 11.28 ? 6 ASN A O 1 5: ATOM 41 C CB . ASN A 1 6 ? 30.023 23.548 37.445 1.00 12.95 ? 6 ASN A CB 1 5: ATOM 42 C CG . ASN A 1 6 ? 29.675 24.816 38.200 1.00 18.08 ? 6 ASN A CG 1 5: ATOM 43 O OD1 . ASN A 1 6 ? 29.022 25.708 37.665 1.00 19.52 ? 6 ASN A OD1 1 5: ATOM 44 N ND2 . ASN A 1 6 ? 30.047 24.872 39.467 1.00 21.23 ? 6 ASN A ND2 1 5: ATOM 45 N N . TRP A 1 7 ? 28.399 21.289 35.272 1.00 8.66 ? 7 TRP A N 1 5: ATOM 46 C CA . TRP A 1 7 ? 28.518 20.119 34.424 1.00 8.74 ? 7 TRP A CA 1 5: ATOM 47 C C . TRP A 1 7 ? 29.246 20.352 33.092 1.00 9.63 ? 7 TRP A C 1 5: ATOM 48 O O . TRP A 1 7 ? 29.064 21.389 32.440 1.00 9.45 ? 7 TRP A O 1 5: ATOM 49 C CB . TRP A 1 7 ? 27.115 19.563 34.152 1.00 8.00 ? 7 TRP A CB 1 5: ATOM 50 C CG . TRP A 1 7 ? 26.325 19.198 35.391 1.00 8.01 ? 7 TRP A CG 1 5: ATOM 51 C CD1 . TRP A 1 7 ? 25.556 20.031 36.159 1.00 8.29 ? 7 TRP A CD1 1 5: ATOM 52 C CD2 . TRP A 1 7 ? 26.174 17.885 35.947 1.00 7.60 ? 7 TRP A CD2 1 5: ATOM 53 N NE1 . TRP A 1 7 ? 24.922 19.308 37.156 1.00 9.20 ? 7 TRP A NE1 1 5: ATOM 54 C CE2 . TRP A 1 7 ? 25.286 17.987 37.046 1.00 8.73 ? 7 TRP A CE2 1 5: ATOM 55 C CE3 . TRP A 1 7 ? 26.694 16.625 35.618 1.00 6.99 ? 7 TRP A CE3 1 5: ATOM 56 C CZ2 . TRP A 1 7 ? 24.909 16.876 37.815 1.00 7.67 ? 7 TRP A CZ2 1 5: ATOM 57 C CZ3 . TRP A 1 7 ? 26.320 15.527 36.380 1.00 7.58 ? 7 TRP A CZ3 1 5: ATOM 58 C CH2 . TRP A 1 7 ? 25.433 15.663 37.468 1.00 5.92 ? 7 TRP A CH2 1 5: ATOM 59 N N . LYS A 1 8 ? 30.052 19.368 32.702 1.00 9.39 ? 8 LYS A N 1 5: ATOM 60 C CA . LYS A 1 8 ? 30.802 19.424 31.450 1.00 11.56 ? 8 LYS A CA 1 5: ATOM 61 C C . LYS A 1 8 ? 30.342 18.243 30.611 1.00 10.56 ? 8 LYS A C 1 5: ATOM 62 O O . LYS A 1 8 ? 30.091 17.158 31.138 1.00 10.14 ? 8 LYS A O 1 5: ATOM 63 C CB . LYS A 1 8 ? 32.308 19.360 31.710 1.00 15.20 ? 8 LYS A CB 1 5: ATOM 64 C CG . LYS A 1 8 ? 32.785 18.080 32.313 1.00 18.52 ? 8 LYS A CG 1 5: ATOM 65 C CD . LYS A 1 8 ? 34.263 18.182 32.618 1.00 26.26 ? 8 LYS A CD 1 5: ATOM 66 C CE . LYS A 1 8 ? 35.091 18.499 31.378 1.00 29.22 ? 8 LYS A CE 1 5: ATOM 67 N NZ . LYS A 1 8 ? 35.067 17.393 30.369 1.00 32.48 ? 8 LYS A NZ 1 5: ATOM 68 N N . ILE A 1 9 ? 30.222 18.447 29.308 1.00 8.21 ? 9 ILE A N 1 5: ATOM 69 C CA . ILE A 1 9 ? 29.739 17.384 28.441 1.00 8.08 ? 9 ILE A CA 1 5: ATOM 70 C C . ILE A 1 9 ? 30.798 16.325 28.117 1.00 7.86 ? 9 ILE A C 1 5: ATOM 71 O O . ILE A 1 9 ? 31.990 16.635 28.028 1.00 8.38 ? 9 ILE A O 1 5: ATOM 72 C CB . ILE A 1 9 ? 29.148 17.997 27.144 1.00 10.70 ? 9 ILE A CB 1 5: ATOM 73 C CG1 . ILE A 1 9 ? 28.285 16.981 26.401 1.00 10.95 ? 9 ILE A CG1 1 5: ATOM 74 C CG2 . ILE A 1 9 ? 30.261 18.500 26.243 1.00 10.70 ? 9 ILE A CG2 1 5: ATOM 75 C CD1 . ILE A 1 9 ? 27.586 17.597 25.207 1.00 13.23 ? 9 ILE A CD1 1 5: ATOM 76 N N . ILE A 1 10 ? 30.373 15.067 27.995 1.00 7.08 ? 10 ILE A N 1 5: ATOM 77 C CA . ILE A 1 10 ? 31.288 13.988 27.656 1.00 7.45 ? 10 ILE A CA 1 5: ATOM 78 C C . ILE A 1 10 ? 30.812 13.201 26.441 1.00 8.49 ? 10 ILE A C 1 5: ATOM 79 O O . ILE A 1 10 ? 31.561 12.397 25.892 1.00 9.49 ? 10 ILE A O 1 5: ATOM 80 C CB . ILE A 1 10 ? 31.586 13.023 28.847 1.00 10.28 ? 10 ILE A CB 1 5: ATOM 81 C CG1 . ILE A 1 10 ? 30.304 12.393 29.382 1.00 10.51 ? 10 ILE A CG1 1 5: ATOM 82 C CG2 . ILE A 1 10 ? 32.349 13.756 29.963 1.00 10.10 ? 10 ILE A CG2 1 5: ATOM 83 C CD1 . ILE A 1 10 ? 30.578 11.242 30.325 1.00 12.18 ? 10 ILE A CD1 1 5: ATOM 84 N N . ARG A 1 11 ? 29.566 13.419 26.030 1.00 7.59 ? 11 ARG A N 1 5: ATOM 85 C CA . ARG A 1 11 ? 29.015 12.742 24.851 1.00 8.70 ? 11 ARG A CA 1 5: ATOM 86 C C . ARG A 1 11 ? 27.821 13.500 24.290 1.00 9.41 ? 11 ARG A C 1 5: ATOM 87 O O . ARG A 1 11 ? 26.990 14.004 25.043 1.00 9.84 ? 11 ARG A O 1 5: ATOM 88 C CB . ARG A 1 11 ? 28.563 11.316 25.184 1.00 8.07 ? 11 ARG A CB 1 5: ATOM 89 C CG . ARG A 1 11 ? 27.912 10.616 23.998 1.00 12.26 ? 11 ARG A CG 1 5: ATOM 90 C CD . ARG A 1 11 ? 27.234 9.340 24.394 1.00 13.46 ? 11 ARG A CD 1 5: ATOM 91 N NE . ARG A 1 11 ? 28.157 8.304 24.847 1.00 15.44 ? 11 ARG A NE 1 5: ATOM 92 C CZ . ARG A 1 11 ? 28.815 7.470 24.037 1.00 19.59 ? 11 ARG A CZ 1 5: ATOM 93 N NH1 . ARG A 1 11 ? 28.677 7.559 22.714 1.00 19.40 ? 11 ARG A NH1 1 5: ATOM 94 N NH2 . ARG A 1 11 ? 29.521 6.467 24.547 1.00 17.50 ? 11 ARG A NH2 1 5: ATOM 95 N N . SER A 1 12 ? 27.748 13.594 22.965 1.00 8.84 ? 12 SER A N 1 5: ATOM 96 C CA . SER A 1 12 ? 26.621 14.245 22.310 1.00 8.61 ? 12 SER A CA 1 5: ATOM 97 C C . SER A 1 12 ? 26.278 13.431 21.063 1.00 9.48 ? 12 SER A C 1 5: ATOM 98 O O . SER A 1 12 ? 27.159 13.147 20.250 1.00 9.84 ? 12 SER A O 1 5: ATOM 99 C CB . SER A 1 12 ? 26.966 15.676 21.925 1.00 9.02 ? 12 SER A CB 1 5: ATOM 100 O OG . SER A 1 12 ? 25.863 16.285 21.273 1.00 11.97 ? 12 SER A OG 1 5: ATOM 101 N N . GLU A 1 13 ? 25.016 13.038 20.924 1.00 7.59 ? 13 GLU A N 1 5: ATOM 102 C CA . GLU A 1 13 ? 24.586 12.258 19.768 1.00 9.67 ? 13 GLU A CA 1 5: ATOM 103 C C . GLU A 1 13 ? 23.368 12.887 19.118 1.00 9.06 ? 13 GLU A C 1 5: ATOM 104 O O . GLU A 1 13 ? 22.457 13.343 19.815 1.00 7.34 ? 13 GLU A O 1 5: ATOM 105 C CB . GLU A 1 13 ? 24.185 10.833 20.184 1.00 9.72 ? 13 GLU A CB 1 5: ATOM 106 C CG . GLU A 1 13 ? 25.257 10.018 20.895 1.00 15.17 ? 13 GLU A CG 1 5: ATOM 107 C CD . GLU A 1 13 ? 26.262 9.340 19.954 1.00 18.75 ? 13 GLU A CD 1 5: ATOM 108 O OE1 . GLU A 1 13 ? 26.031 9.310 18.726 1.00 18.53 ? 13 GLU A OE1 1 5: ATOM 109 O OE2 . GLU A 1 13 ? 27.286 8.822 20.457 1.00 19.23 ? 13 GLU A OE2 1 5: ATOM 110 N N . ASN A 1 14 ? 23.363 12.919 17.786 1.00 8.79 ? 14 ASN A N 1 5: ATOM 111 C CA . ASN A 1 14 ? 22.202 13.408 17.025 1.00 8.29 ? 14 ASN A CA 1 5: ATOM 112 C C . ASN A 1 14 ? 21.813 14.896 17.153 1.00 7.35 ? 14 ASN A C 1 5: ATOM 113 O O . ASN A 1 14 ? 20.681 15.245 16.860 1.00 7.00 ? 14 ASN A O 1 5: ATOM 114 C CB . ASN A 1 14 ? 20.989 12.522 17.383 1.00 7.23 ? 14 ASN A CB 1 5: ATOM 115 C CG . ASN A 1 14 ? 20.358 11.833 16.172 1.00 9.38 ? 14 ASN A CG 1 5: ATOM 116 O OD1 . ASN A 1 14 ? 20.996 11.670 15.128 1.00 10.37 ? 14 ASN A OD1 1 5: ATOM 117 N ND2 . ASN A 1 14 ? 19.106 11.436 16.310 1.00 6.35 ? 14 ASN A ND2 1 5: ATOM 118 N N . PHE A 1 15 ? 22.734 15.777 17.536 1.00 7.26 ? 15 PHE A N 1 5: ATOM 119 C CA . PHE A 1 15 ? 22.385 17.198 17.681 1.00 9.06 ? 15 PHE A CA 1 5: ATOM 120 C C . PHE A 1 15 ? 22.041 17.878 16.358 1.00 9.15 ? 15 PHE A C 1 5: ATOM 121 O O . PHE A 1 15 ? 21.041 18.578 16.265 1.00 8.64 ? 15 PHE A O 1 5: ATOM 122 C CB . PHE A 1 15 ? 23.497 17.990 18.379 1.00 10.05 ? 15 PHE A CB 1 5: ATOM 123 C CG . PHE A 1 15 ? 23.102 19.397 18.746 1.00 10.57 ? 15 PHE A CG 1 5: ATOM 124 C CD1 . PHE A 1 15 ? 22.032 19.633 19.605 1.00 13.39 ? 15 PHE A CD1 1 5: ATOM 125 C CD2 . PHE A 1 15 ? 23.813 20.485 18.254 1.00 11.47 ? 15 PHE A CD2 1 5: ATOM 126 C CE1 . PHE A 1 15 ? 21.678 20.929 19.968 1.00 13.52 ? 15 PHE A CE1 1 5: ATOM 127 C CE2 . PHE A 1 15 ? 23.467 21.784 18.609 1.00 11.60 ? 15 PHE A CE2 1 5: ATOM 128 C CZ . PHE A 1 15 ? 22.399 22.006 19.469 1.00 13.52 ? 15 PHE A CZ 1 5: ATOM 129 N N . GLU A 1 16 ? 22.878 17.699 15.342 1.00 11.17 ? 16 GLU A N 1 5: ATOM 130 C CA . GLU A 1 16 ? 22.583 18.313 14.053 1.00 12.58 ? 16 GLU A CA 1 5: ATOM 131 C C . GLU A 1 16 ? 21.271 17.797 13.468 1.00 11.71 ? 16 GLU A C 1 5: ATOM 132 O O . GLU A 1 16 ? 20.503 18.567 12.888 1.00 12.66 ? 16 GLU A O 1 5: ATOM 133 C CB . GLU A 1 16 ? 23.711 18.081 13.060 1.00 15.91 ? 16 GLU A CB 1 5: ATOM 134 C CG . GLU A 1 16 ? 23.274 18.337 11.626 1.00 21.31 ? 16 GLU A CG 1 5: ATOM 135 C CD . GLU A 1 16 ? 24.376 18.878 10.757 1.00 25.39 ? 16 GLU A CD 1 5: ATOM 136 O OE1 . GLU A 1 16 ? 25.526 18.984 11.240 1.00 27.92 ? 16 GLU A OE1 1 5: ATOM 137 O OE2 . GLU A 1 16 ? 24.084 19.213 9.588 1.00 28.60 ? 16 GLU A OE2 1 5: ATOM 138 N N . GLU A 1 17 ? 21.018 16.497 13.619 1.00 11.67 ? 17 GLU A N 1 5: ATOM 139 C CA . GLU A 1 17 ? 19.785 15.878 13.116 1.00 13.65 ? 17 GLU A CA 1 5: ATOM 140 C C . GLU A 1 17 ? 18.529 16.490 13.767 1.00 13.48 ? 17 GLU A C 1 5: ATOM 141 O O . GLU A 1 17 ? 17.490 16.662 13.115 1.00 11.68 ? 17 GLU A O 1 5: ATOM 142 C CB . GLU A 1 17 ? 19.811 14.361 13.325 1.00 17.06 ? 17 GLU A CB 1 5: ATOM 143 C CG . GLU A 1 17 ? 20.806 13.602 12.430 1.00 23.45 ? 17 GLU A CG 1 5: ATOM 144 C CD . GLU A 1 17 ? 22.279 13.624 12.909 1.00 27.80 ? 17 GLU A CD 1 5: ATOM 145 O OE1 . GLU A 1 17 ? 22.637 14.338 13.881 1.00 26.52 ? 17 GLU A OE1 1 5: ATOM 146 O OE2 . GLU A 1 17 ? 23.097 12.897 12.291 1.00 31.80 ? 17 GLU A OE2 1 5: ATOM 147 N N . LEU A 1 18 ? 18.640 16.834 15.048 1.00 10.82 ? 18 LEU A N 1 5: ATOM 148 C CA . LEU A 1 18 ? 17.547 17.468 15.777 1.00 9.45 ? 18 LEU A CA 1 5: ATOM 149 C C . LEU A 1 18 ? 17.302 18.849 15.155 1.00 9.27 ? 18 LEU A C 1 5: ATOM 150 O O . LEU A 1 18 ? 16.153 19.246 14.927 1.00 9.04 ? 18 LEU A O 1 5: ATOM 151 C CB . LEU A 1 18 ? 17.931 17.644 17.253 1.00 9.77 ? 18 LEU A CB 1 5: ATOM 152 C CG . LEU A 1 18 ? 16.921 18.358 18.163 1.00 11.36 ? 18 LEU A CG 1 5: ATOM 153 C CD1 . LEU A 1 18 ? 15.817 17.402 18.554 1.00 13.85 ? 18 LEU A CD1 1 5: ATOM 154 C CD2 . LEU A 1 18 ? 17.616 18.876 19.409 1.00 12.69 ? 18 LEU A CD2 1 5: ATOM 155 N N . LEU A 1 19 ? 18.387 19.568 14.864 1.00 10.75 ? 19 LEU A N 1 5: ATOM 156 C CA . LEU A 1 19 ? 18.275 20.906 14.276 1.00 11.15 ? 19 LEU A CA 1 5: ATOM 157 C C . LEU A 1 19 ? 17.671 20.873 12.874 1.00 12.52 ? 19 LEU A C 1 5: ATOM 158 O O . LEU A 1 19 ? 16.932 21.777 12.485 1.00 10.05 ? 19 LEU A O 1 5: ATOM 159 C CB . LEU A 1 19 ? 19.631 21.616 14.263 1.00 12.01 ? 19 LEU A CB 1 5: ATOM 160 C CG . LEU A 1 19 ? 20.282 21.963 15.614 1.00 10.42 ? 19 LEU A CG 1 5: ATOM 161 C CD1 . LEU A 1 19 ? 21.560 22.763 15.369 1.00 13.01 ? 19 LEU A CD1 1 5: ATOM 162 C CD2 . LEU A 1 19 ? 19.312 22.742 16.513 1.00 11.45 ? 19 LEU A CD2 1 5: ATOM 163 N N . LYS A 1 20 ? 17.944 19.795 12.150 1.00 14.41 ? 20 LYS A N 1 5: ATOM 164 C CA . LYS A 1 20 ? 17.427 19.628 10.800 1.00 16.54 ? 20 LYS A CA 1 5: ATOM 165 C C . LYS A 1 20 ? 15.902 19.512 10.832 1.00 16.17 ? 20 LYS A C 1 5: ATOM 166 O O . LYS A 1 20 ? 15.201 20.164 10.053 1.00 15.90 ? 20 LYS A O 1 5: ATOM 167 C CB . LYS A 1 20 ? 18.048 18.390 10.157 1.00 20.07 ? 20 LYS A CB 1 5: ATOM 168 C CG . LYS A 1 20 ? 18.592 18.643 8.765 1.00 26.61 ? 20 LYS A CG 1 5: ATOM 169 C CD . LYS A 1 20 ? 18.960 17.349 8.027 1.00 30.95 ? 20 LYS A CD 1 5: ATOM 170 C CE . LYS A 1 20 ? 20.226 16.690 8.579 1.00 35.68 ? 20 LYS A CE 1 5: ATOM 171 N NZ . LYS A 1 20 ? 21.485 17.466 8.342 1.00 39.27 ? 20 LYS A NZ 1 5: ATOM 172 N N . VAL A 1 21 ? 15.395 18.700 11.759 1.00 15.31 ? 21 VAL A N 1 5: ATOM 173 C CA . VAL A 1 21 ? 13.958 18.508 11.927 1.00 14.41 ? 21 VAL A CA 1 5: ATOM 174 C C . VAL A 1 21 ? 13.275 19.831 12.316 1.00 15.02 ? 21 VAL A C 1 5: ATOM 175 O O . VAL A 1 21 ? 12.150 20.119 11.878 1.00 13.59 ? 21 VAL A O 1 5: ATOM 176 C CB . VAL A 1 21 ? 13.674 17.422 12.998 1.00 14.93 ? 21 VAL A CB 1 5: ATOM 177 C CG1 . VAL A 1 21 ? 12.194 17.383 13.364 1.00 17.29 ? 21 VAL A CG1 1 5: ATOM 178 C CG2 . VAL A 1 21 ? 14.115 16.082 12.482 1.00 15.09 ? 21 VAL A CG2 1 5: ATOM 179 N N . LEU A 1 22 ? 13.966 20.643 13.119 1.00 14.52 ? 22 LEU A N 1 5: ATOM 180 C CA . LEU A 1 22 ? 13.432 21.938 13.569 1.00 14.42 ? 22 LEU A CA 1 5: ATOM 181 C C . LEU A 1 22 ? 13.478 22.984 12.467 1.00 15.49 ? 22 LEU A C 1 5: ATOM 182 O O . LEU A 1 22 ? 13.038 24.115 12.666 1.00 16.81 ? 22 LEU A O 1 5: ATOM 183 C CB . LEU A 1 22 ? 14.180 22.440 14.818 1.00 13.61 ? 22 LEU A CB 1 5: ATOM 184 C CG . LEU A 1 22 ? 13.986 21.565 16.069 1.00 13.97 ? 22 LEU A CG 1 5: ATOM 185 C CD1 . LEU A 1 22 ? 14.852 22.047 17.225 1.00 13.25 ? 22 LEU A CD1 1 5: ATOM 186 C CD2 . LEU A 1 22 ? 12.525 21.580 16.467 1.00 14.62 ? 22 LEU A CD2 1 5: ATOM 187 N N . GLY A 1 23 ? 14.062 22.618 11.328 1.00 16.41 ? 23 GLY A N 1 5: ATOM 188 C CA . GLY A 1 23 ? 14.123 23.516 10.183 1.00 17.05 ? 23 GLY A CA 1 5: ATOM 189 C C . GLY A 1 23 ? 15.241 24.539 10.125 1.00 18.00 ? 23 GLY A C 1 5: ATOM 190 O O . GLY A 1 23 ? 15.112 25.545 9.425 1.00 19.45 ? 23 GLY A O 1 5: ATOM 191 N N . VAL A 1 24 ? 16.320 24.315 10.869 1.00 14.78 ? 24 VAL A N 1 5: ATOM 192 C CA . VAL A 1 24 ? 17.440 25.241 10.860 1.00 13.71 ? 24 VAL A CA 1 5: ATOM 193 C C . VAL A 1 24 ? 18.289 24.983 9.607 1.00 15.09 ? 24 VAL A C 1 5: ATOM 194 O O . VAL A 1 24 ? 18.679 23.840 9.334 1.00 14.12 ? 24 VAL A O 1 5: ATOM 195 C CB . VAL A 1 24 ? 18.297 25.081 12.139 1.00 12.19 ? 24 VAL A CB 1 5: ATOM 196 C CG1 . VAL A 1 24 ? 19.465 26.054 12.109 1.00 8.69 ? 24 VAL A CG1 1 5: ATOM 197 C CG2 . VAL A 1 24 ? 17.416 25.294 13.388 1.00 11.37 ? 24 VAL A CG2 1 5: ATOM 198 N N . ASN A 1 25 ? 18.595 26.047 8.866 1.00 15.37 ? 25 ASN A N 1 5: ATOM 199 C CA . ASN A 1 25 ? 19.360 25.914 7.635 1.00 17.74 ? 25 ASN A CA 1 5: ATOM 200 C C . ASN A 1 25 ? 20.808 25.466 7.819 1.00 18.29 ? 25 ASN A C 1 5: ATOM 201 O O . ASN A 1 25 ? 21.377 25.592 8.903 1.00 18.05 ? 25 ASN A O 1 5: ATOM 202 C CB . ASN A 1 25 ? 19.230 27.172 6.742 1.00 19.41 ? 25 ASN A CB 1 5: ATOM 203 C CG . ASN A 1 25 ? 20.090 28.351 7.200 1.00 22.35 ? 25 ASN A CG 1 5: ATOM 204 O OD1 . ASN A 1 25 ? 21.207 28.189 7.698 1.00 22.64 ? 25 ASN A OD1 1 5: ATOM 205 N ND2 . ASN A 1 25 ? 19.602 29.558 6.933 1.00 24.15 ? 25 ASN A ND2 1 5: ATOM 206 N N . VAL A 1 26 ? 21.398 24.971 6.733 1.00 18.67 ? 26 VAL A N 1 5: ATOM 207 C CA . VAL A 1 26 ? 22.755 24.444 6.742 1.00 19.24 ? 26 VAL A CA 1 5: ATOM 208 C C . VAL A 1 26 ? 23.825 25.280 7.421 1.00 18.39 ? 26 VAL A C 1 5: ATOM 209 O O . VAL A 1 26 ? 24.558 24.764 8.261 1.00 18.50 ? 26 VAL A O 1 5: ATOM 210 C CB . VAL A 1 26 ? 23.223 24.088 5.320 1.00 20.77 ? 26 VAL A CB 1 5: ATOM 211 C CG1 . VAL A 1 26 ? 24.624 23.523 5.378 1.00 22.39 ? 26 VAL A CG1 1 5: ATOM 212 C CG2 . VAL A 1 26 ? 22.276 23.084 4.698 1.00 21.28 ? 26 VAL A CG2 1 5: ATOM 213 N N . MET A 1 27 ? 23.932 26.556 7.052 1.00 19.00 ? 27 MET A N 1 5: ATOM 214 C CA . MET A 1 27 ? 24.948 27.433 7.628 1.00 19.54 ? 27 MET A CA 1 5: ATOM 215 C C . MET A 1 27 ? 24.734 27.741 9.099 1.00 19.04 ? 27 MET A C 1 5: ATOM 216 O O . MET A 1 27 ? 25.702 27.820 9.849 1.00 18.28 ? 27 MET A O 1 5: ATOM 217 C CB . MET A 1 27 ? 25.104 28.736 6.830 1.00 23.31 ? 27 MET A CB 1 5: ATOM 218 C CG . MET A 1 27 ? 25.955 28.602 5.552 1.00 29.99 ? 27 MET A CG 1 5: ATOM 219 S SD . MET A 1 27 ? 24.975 28.527 4.010 1.00 37.48 ? 27 MET A SD 1 5: ATOM 220 C CE . MET A 1 27 ? 26.198 29.150 2.776 1.00 35.24 ? 27 MET A CE 1 5: ATOM 221 N N . LEU A 1 28 ? 23.480 27.932 9.507 1.00 16.74 ? 28 LEU A N 1 5: ATOM 222 C CA . LEU A 1 28 ? 23.190 28.209 10.912 1.00 16.39 ? 28 LEU A CA 1 5: ATOM 223 C C . LEU A 1 28 ? 23.477 26.954 11.722 1.00 16.86 ? 28 LEU A C 1 5: ATOM 224 O O . LEU A 1 28 ? 23.954 27.038 12.852 1.00 15.09 ? 28 LEU A O 1 5: ATOM 225 C CB . LEU A 1 28 ? 21.739 28.679 11.111 1.00 15.94 ? 28 LEU A CB 1 5: ATOM 226 C CG . LEU A 1 28 ? 21.490 30.154 10.741 1.00 16.72 ? 28 LEU A CG 1 5: ATOM 227 C CD1 . LEU A 1 28 ? 20.008 30.496 10.780 1.00 14.38 ? 28 LEU A CD1 1 5: ATOM 228 C CD2 . LEU A 1 28 ? 22.302 31.074 11.665 1.00 12.81 ? 28 LEU A CD2 1 5: ATOM 229 N N . ARG A 1 29 ? 23.228 25.791 11.121 1.00 16.05 ? 29 ARG A N 1 5: ATOM 230 C CA . ARG A 1 29 ? 23.498 24.524 11.798 1.00 18.43 ? 29 ARG A CA 1 5: ATOM 231 C C . ARG A 1 29 ? 24.980 24.377 12.076 1.00 19.22 ? 29 ARG A C 1 5: ATOM 232 O O . ARG A 1 29 ? 25.383 23.987 13.171 1.00 17.97 ? 29 ARG A O 1 5: ATOM 233 C CB . ARG A 1 29 ? 23.030 23.334 10.969 1.00 18.63 ? 29 ARG A CB 1 5: ATOM 234 C CG . ARG A 1 29 ? 21.596 22.983 11.189 1.00 21.26 ? 29 ARG A CG 1 5: ATOM 235 C CD . ARG A 1 29 ? 21.339 21.572 10.739 1.00 24.71 ? 29 ARG A CD 1 5: ATOM 236 N NE . ARG A 1 29 ? 20.571 21.564 9.513 1.00 29.88 ? 29 ARG A NE 1 5: ATOM 237 C CZ . ARG A 1 29 ? 21.019 21.147 8.340 1.00 29.19 ? 29 ARG A CZ 1 5: ATOM 238 N NH1 . ARG A 1 29 ? 22.248 20.682 8.205 1.00 30.52 ? 29 ARG A NH1 1 5: ATOM 239 N NH2 . ARG A 1 29 ? 20.232 21.233 7.295 1.00 31.61 ? 29 ARG A NH2 1 5: ATOM 240 N N . LYS A 1 30 ? 25.790 24.709 11.078 1.00 19.76 ? 30 LYS A N 1 5: ATOM 241 C CA . LYS A 1 30 ? 27.235 24.619 11.198 1.00 21.96 ? 30 LYS A CA 1 5: ATOM 242 C C . LYS A 1 30 ? 27.706 25.418 12.417 1.00 20.91 ? 30 LYS A C 1 5: ATOM 243 O O . LYS A 1 30 ? 28.470 24.916 13.239 1.00 22.15 ? 30 LYS A O 1 5: ATOM 244 C CB . LYS A 1 30 ? 27.894 25.143 9.915 1.00 25.07 ? 30 LYS A CB 1 5: ATOM 245 C CG . LYS A 1 30 ? 29.404 25.031 9.905 1.00 30.48 ? 30 LYS A CG 1 5: ATOM 246 C CD . LYS A 1 30 ? 30.013 25.631 8.639 1.00 35.43 ? 30 LYS A CD 1 5: ATOM 247 C CE . LYS A 1 30 ? 31.533 25.759 8.778 1.00 37.96 ? 30 LYS A CE 1 5: ATOM 248 N NZ . LYS A 1 30 ? 32.180 26.388 7.584 1.00 41.61 ? 30 LYS A NZ 1 5: ATOM 249 N N . ILE A 1 31 ? 27.208 26.643 12.544 1.00 18.38 ? 31 ILE A N 1 5: ATOM 250 C CA . ILE A 1 31 ? 27.557 27.527 13.652 1.00 16.41 ? 31 ILE A CA 1 5: ATOM 251 C C . ILE A 1 31 ? 27.105 26.932 14.989 1.00 15.39 ? 31 ILE A C 1 5: ATOM 252 O O . ILE A 1 31 ? 27.888 26.855 15.930 1.00 14.90 ? 31 ILE A O 1 5: ATOM 253 C CB . ILE A 1 31 ? 26.881 28.920 13.471 1.00 16.63 ? 31 ILE A CB 1 5: ATOM 254 C CG1 . ILE A 1 31 ? 27.419 29.606 12.208 1.00 18.74 ? 31 ILE A CG1 1 5: ATOM 255 C CG2 . ILE A 1 31 ? 27.071 29.791 14.713 1.00 15.71 ? 31 ILE A CG2 1 5: ATOM 256 C CD1 . ILE A 1 31 ? 26.735 30.946 11.858 1.00 17.27 ? 31 ILE A CD1 1 5: ATOM 257 N N . ALA A 1 32 ? 25.853 26.487 15.048 1.00 13.39 ? 32 ALA A N 1 5: ATOM 258 C CA . ALA A 1 32 ? 25.271 25.930 16.267 1.00 12.76 ? 32 ALA A CA 1 5: ATOM 259 C C . ALA A 1 32 ? 25.994 24.685 16.775 1.00 12.11 ? 32 ALA A C 1 5: ATOM 260 O O . ALA A 1 32 ? 26.325 24.598 17.946 1.00 10.54 ? 32 ALA A O 1 5: ATOM 261 C CB . ALA A 1 32 ? 23.790 25.638 16.040 1.00 12.45 ? 32 ALA A CB 1 5: ATOM 262 N N . VAL A 1 33 ? 26.252 23.731 15.886 1.00 11.95 ? 33 VAL A N 1 5: ATOM 263 C CA . VAL A 1 33 ? 26.932 22.490 16.256 1.00 13.80 ? 33 VAL A CA 1 5: ATOM 264 C C . VAL A 1 33 ? 28.328 22.701 16.855 1.00 14.00 ? 33 VAL A C 1 5: ATOM 265 O O . VAL A 1 33 ? 28.693 22.048 17.832 1.00 14.07 ? 33 VAL A O 1 5: ATOM 266 C CB . VAL A 1 33 ? 27.016 21.504 15.044 1.00 13.56 ? 33 VAL A CB 1 5: ATOM 267 C CG1 . VAL A 1 33 ? 27.909 20.318 15.375 1.00 16.07 ? 33 VAL A CG1 1 5: ATOM 268 C CG2 . VAL A 1 33 ? 25.621 21.006 14.684 1.00 14.96 ? 33 VAL A CG2 1 5: ATOM 269 N N . ALA A 1 34 ? 29.101 23.620 16.281 1.00 14.73 ? 34 ALA A N 1 5: ATOM 270 C CA . ALA A 1 34 ? 30.443 23.898 16.780 1.00 14.95 ? 34 ALA A CA 1 5: ATOM 271 C C . ALA A 1 34 ? 30.381 24.505 18.178 1.00 15.59 ? 34 ALA A C 1 5: ATOM 272 O O . ALA A 1 34 ? 31.120 24.085 19.065 1.00 16.65 ? 34 ALA A O 1 5: ATOM 273 C CB . ALA A 1 34 ? 31.191 24.844 15.833 1.00 16.10 ? 34 ALA A CB 1 5: ATOM 274 N N . ALA A 1 35 ? 29.495 25.480 18.375 1.00 13.20 ? 35 ALA A N 1 5: ATOM 275 C CA . ALA A 1 35 ? 29.371 26.134 19.671 1.00 13.04 ? 35 ALA A CA 1 5: ATOM 276 C C . ALA A 1 35 ? 28.807 25.200 20.749 1.00 12.91 ? 35 ALA A C 1 5: ATOM 277 O O . ALA A 1 35 ? 29.245 25.239 21.895 1.00 12.32 ? 35 ALA A O 1 5: ATOM 278 C CB . ALA A 1 35 ? 28.517 27.387 19.552 1.00 12.14 ? 35 ALA A CB 1 5: ATOM 279 N N . ALA A 1 36 ? 27.878 24.332 20.362 1.00 11.40 ? 36 ALA A N 1 5: ATOM 280 C CA . ALA A 1 36 ? 27.253 23.416 21.312 1.00 12.63 ? 36 ALA A CA 1 5: ATOM 281 C C . ALA A 1 36 ? 28.128 22.256 21.770 1.00 13.40 ? 36 ALA A C 1 5: ATOM 282 O O . ALA A 1 36 ? 27.743 21.512 22.668 1.00 13.47 ? 36 ALA A O 1 5: ATOM 283 C CB . ALA A 1 36 ? 25.952 22.883 20.744 1.00 11.79 ? 36 ALA A CB 1 5: ATOM 284 N N . SER A 1 37 ? 29.286 22.080 21.148 1.00 13.86 ? 37 SER A N 1 5: ATOM 285 C CA . SER A 1 37 ? 30.169 20.983 21.520 1.00 15.95 ? 37 SER A CA 1 5: ATOM 286 C C . SER A 1 37 ? 30.938 21.245 22.818 1.00 16.46 ? 37 SER A C 1 5: ATOM 287 O O . SER A 1 37 ? 31.488 20.320 23.406 1.00 18.23 ? 37 SER A O 1 5: ATOM 288 C CB . SER A 1 37 ? 31.145 20.689 20.388 1.00 16.93 ? 37 SER A CB 1 5: ATOM 289 O OG . SER A 1 37 ? 32.100 21.729 20.293 1.00 21.65 ? 37 SER A OG 1 5: ATOM 290 N N . LYS A 1 38 ? 30.957 22.496 23.272 1.00 16.91 ? 38 LYS A N 1 5: ATOM 291 C CA . LYS A 1 38 ? 31.657 22.869 24.502 1.00 18.36 ? 38 LYS A CA 1 5: ATOM 292 C C . LYS A 1 38 ? 30.817 23.809 25.382 1.00 15.90 ? 38 LYS A C 1 5: ATOM 293 O O . LYS A 1 38 ? 31.175 24.975 25.591 1.00 16.72 ? 38 LYS A O 1 5: ATOM 294 C CB . LYS A 1 38 ? 33.004 23.539 24.156 1.00 23.99 ? 38 LYS A CB 1 5: ATOM 295 C CG . LYS A 1 38 ? 32.907 24.607 23.046 1.00 30.97 ? 38 LYS A CG 1 5: ATOM 296 C CD . LYS A 1 38 ? 34.250 25.320 22.792 1.00 36.44 ? 38 LYS A CD 1 5: ATOM 297 C CE . LYS A 1 38 ? 34.266 26.098 21.456 1.00 38.70 ? 38 LYS A CE 1 5: ATOM 298 N NZ . LYS A 1 38 ? 33.193 27.131 21.321 1.00 39.37 ? 38 LYS A NZ 1 5: ATOM 299 N N . PRO A 1 39 ? 29.669 23.321 25.906 1.00 13.53 ? 39 PRO A N 1 5: ATOM 300 C CA . PRO A 1 39 ? 28.851 24.201 26.747 1.00 11.87 ? 39 PRO A CA 1 5: ATOM 301 C C . PRO A 1 39 ? 29.292 24.248 28.211 1.00 12.05 ? 39 PRO A C 1 5: ATOM 302 O O . PRO A 1 39 ? 30.027 23.380 28.676 1.00 12.12 ? 39 PRO A O 1 5: ATOM 303 C CB . PRO A 1 39 ? 27.469 23.560 26.649 1.00 9.34 ? 39 PRO A CB 1 5: ATOM 304 C CG . PRO A 1 39 ? 27.779 22.131 26.593 1.00 10.32 ? 39 PRO A CG 1 5: ATOM 305 C CD . PRO A 1 39 ? 29.009 22.020 25.703 1.00 10.86 ? 39 PRO A CD 1 5: ATOM 306 N N . ALA A 1 40 ? 28.921 25.316 28.898 1.00 11.52 ? 40 ALA A N 1 5: ATOM 307 C CA . ALA A 1 40 ? 29.192 25.423 30.329 1.00 11.84 ? 40 ALA A CA 1 5: ATOM 308 C C . ALA A 1 40 ? 27.773 25.329 30.894 1.00 10.23 ? 40 ALA A C 1 5: ATOM 309 O O . ALA A 1 40 ? 26.894 26.080 30.478 1.00 10.42 ? 40 ALA A O 1 5: ATOM 310 C CB . ALA A 1 40 ? 29.830 26.767 30.673 1.00 11.40 ? 40 ALA A CB 1 5: ATOM 311 N N . VAL A 1 41 ? 27.518 24.345 31.750 1.00 10.73 ? 41 VAL A N 1 5: ATOM 312 C CA . VAL A 1 41 ? 26.185 24.169 32.333 1.00 9.92 ? 41 VAL A CA 1 5: ATOM 313 C C . VAL A 1 41 ? 26.226 24.295 33.854 1.00 11.64 ? 41 VAL A C 1 5: ATOM 314 O O . VAL A 1 41 ? 27.026 23.627 34.514 1.00 11.40 ? 41 VAL A O 1 5: ATOM 315 C CB . VAL A 1 41 ? 25.594 22.772 31.987 1.00 10.67 ? 41 VAL A CB 1 5: ATOM 316 C CG1 . VAL A 1 41 ? 24.204 22.596 32.612 1.00 11.34 ? 41 VAL A CG1 1 5: ATOM 317 C CG2 . VAL A 1 41 ? 25.507 22.583 30.475 1.00 11.31 ? 41 VAL A CG2 1 5: ATOM 318 N N . GLU A 1 42 ? 25.364 25.147 34.399 1.00 10.94 ? 42 GLU A N 1 5: ATOM 319 C CA . GLU A 1 42 ? 25.271 25.327 35.845 1.00 12.40 ? 42 GLU A CA 1 5: ATOM 320 C C . GLU A 1 42 ? 23.837 25.095 36.316 1.00 11.42 ? 42 GLU A C 1 5: ATOM 321 O O . GLU A 1 42 ? 22.898 25.720 35.825 1.00 10.46 ? 42 GLU A O 1 5: ATOM 322 C CB . GLU A 1 42 ? 25.711 26.721 36.270 1.00 16.26 ? 42 GLU A CB 1 5: ATOM 323 C CG . GLU A 1 42 ? 25.495 26.947 37.768 1.00 23.78 ? 42 GLU A CG 1 5: ATOM 324 C CD . GLU A 1 42 ? 25.944 28.311 38.242 1.00 27.94 ? 42 GLU A CD 1 5: ATOM 325 O OE1 . GLU A 1 42 ? 25.308 29.329 37.872 1.00 29.92 ? 42 GLU A OE1 1 5: ATOM 326 O OE2 . GLU A 1 42 ? 26.935 28.351 39.002 1.00 32.64 ? 42 GLU A OE2 1 5: ATOM 327 N N . ILE A 1 43 ? 23.673 24.176 37.261 1.00 10.55 ? 43 ILE A N 1 5: ATOM 328 C CA . ILE A 1 43 ? 22.362 23.864 37.794 1.00 10.69 ? 43 ILE A CA 1 5: ATOM 329 C C . ILE A 1 43 ? 22.360 24.120 39.300 1.00 11.07 ? 43 ILE A C 1 5: ATOM 330 O O . ILE A 1 43 ? 23.307 23.764 39.992 1.00 10.83 ? 43 ILE A O 1 5: ATOM 331 C CB . ILE A 1 43 ? 21.996 22.374 37.552 1.00 10.47 ? 43 ILE A CB 1 5: ATOM 332 C CG1 . ILE A 1 43 ? 21.974 22.072 36.056 1.00 10.46 ? 43 ILE A CG1 1 5: ATOM 333 C CG2 . ILE A 1 43 ? 20.636 22.031 38.186 1.00 10.34 ? 43 ILE A CG2 1 5: ATOM 334 C CD1 . ILE A 1 43 ? 21.607 20.639 35.726 1.00 9.00 ? 43 ILE A CD1 1 5: ATOM 335 N N . LYS A 1 44 ? 21.315 24.784 39.778 1.00 12.26 ? 44 LYS A N 1 5: ATOM 336 C CA . LYS A 1 44 ? 21.127 25.051 41.201 1.00 13.96 ? 44 LYS A CA 1 5: ATOM 337 C C . LYS A 1 44 ? 19.729 24.528 41.516 1.00 14.16 ? 44 LYS A C 1 5: ATOM 338 O O . LYS A 1 44 ? 18.749 24.920 40.873 1.00 14.12 ? 44 LYS A O 1 5: ATOM 339 C CB . LYS A 1 44 ? 21.220 26.545 41.503 1.00 16.58 ? 44 LYS A CB 1 5: ATOM 340 C CG . LYS A 1 44 ? 22.580 27.150 41.170 1.00 22.90 ? 44 LYS A CG 1 5: ATOM 341 C CD . LYS A 1 44 ? 22.571 28.654 41.385 1.00 29.01 ? 44 LYS A CD 1 5: ATOM 342 C CE . LYS A 1 44 ? 23.890 29.293 40.982 1.00 31.56 ? 44 LYS A CE 1 5: ATOM 343 N NZ . LYS A 1 44 ? 23.818 30.781 41.111 1.00 34.70 ? 44 LYS A NZ 1 5: ATOM 344 N N . GLN A 1 45 ? 19.649 23.594 42.460 1.00 15.66 ? 45 GLN A N 1 5: ATOM 345 C CA . GLN A 1 45 ? 18.377 22.993 42.852 1.00 16.03 ? 45 GLN A CA 1 5: ATOM 346 C C . GLN A 1 45 ? 18.098 23.182 44.342 1.00 17.60 ? 45 GLN A C 1 5: ATOM 347 O O . GLN A 1 45 ? 18.989 23.024 45.164 1.00 17.17 ? 45 GLN A O 1 5: ATOM 348 C CB . GLN A 1 45 ? 18.397 21.498 42.544 1.00 15.51 ? 45 GLN A CB 1 5: ATOM 349 C CG . GLN A 1 45 ? 17.168 20.744 43.015 1.00 13.62 ? 45 GLN A CG 1 5: ATOM 350 C CD . GLN A 1 45 ? 17.312 19.256 42.838 1.00 15.68 ? 45 GLN A CD 1 5: ATOM 351 O OE1 . GLN A 1 45 ? 18.348 18.769 42.397 1.00 18.84 ? 45 GLN A OE1 1 5: ATOM 352 N NE2 . GLN A 1 45 ? 16.276 18.521 43.177 1.00 16.73 ? 45 GLN A NE2 1 5: ATOM 353 N N . GLU A 1 46 ? 16.868 23.551 44.670 1.00 18.48 ? 46 GLU A N 1 5: ATOM 354 C CA . GLU A 1 46 ? 16.441 23.718 46.062 1.00 21.26 ? 46 GLU A CA 1 5: ATOM 355 C C . GLU A 1 46 ? 15.108 23.004 46.105 1.00 19.06 ? 46 GLU A C 1 5: ATOM 356 O O . GLU A 1 46 ? 14.080 23.589 45.784 1.00 20.08 ? 46 GLU A O 1 5: ATOM 357 C CB . GLU A 1 46 ? 16.239 25.194 46.408 1.00 26.45 ? 46 GLU A CB 1 5: ATOM 358 C CG . GLU A 1 46 ? 17.284 25.787 47.361 1.00 37.46 ? 46 GLU A CG 1 5: ATOM 359 C CD . GLU A 1 46 ? 17.093 25.374 48.832 1.00 42.24 ? 46 GLU A CD 1 5: ATOM 360 O OE1 . GLU A 1 46 ? 16.192 25.944 49.501 1.00 44.05 ? 46 GLU A OE1 1 5: ATOM 361 O OE2 . GLU A 1 46 ? 17.867 24.507 49.320 1.00 44.14 ? 46 GLU A OE2 1 5: ATOM 362 N N . GLY A 1 47 ? 15.131 21.720 46.429 1.00 18.35 ? 47 GLY A N 1 5: ATOM 363 C CA . GLY A 1 47 ? 13.893 20.970 46.463 1.00 18.96 ? 47 GLY A CA 1 5: ATOM 364 C C . GLY A 1 47 ? 13.382 20.755 45.053 1.00 18.27 ? 47 GLY A C 1 5: ATOM 365 O O . GLY A 1 47 ? 14.067 20.157 44.238 1.00 18.05 ? 47 GLY A O 1 5: ATOM 366 N N . ASP A 1 48 ? 12.194 21.262 44.755 1.00 16.66 ? 48 ASP A N 1 5: ATOM 367 C CA . ASP A 1 48 ? 11.617 21.107 43.420 1.00 16.86 ? 48 ASP A CA 1 5: ATOM 368 C C . ASP A 1 48 ? 11.771 22.378 42.566 1.00 15.92 ? 48 ASP A C 1 5: ATOM 369 O O . ASP A 1 48 ? 11.139 22.511 41.504 1.00 14.50 ? 48 ASP A O 1 5: ATOM 370 C CB . ASP A 1 48 ? 10.136 20.694 43.513 1.00 19.00 ? 48 ASP A CB 1 5: ATOM 371 C CG . ASP A 1 48 ? 9.943 19.221 43.897 1.00 21.49 ? 48 ASP A CG 1 5: ATOM 372 O OD1 . ASP A 1 48 ? 10.901 18.406 43.840 1.00 23.51 ? 48 ASP A OD1 1 5: ATOM 373 O OD2 . ASP A 1 48 ? 8.802 18.868 44.243 1.00 25.04 ? 48 ASP A OD2 1 5: ATOM 374 N N . THR A 1 49 ? 12.610 23.299 43.042 1.00 13.75 ? 49 THR A N 1 5: ATOM 375 C CA . THR A 1 49 ? 12.870 24.551 42.348 1.00 13.82 ? 49 THR A CA 1 5: ATOM 376 C C . THR A 1 49 ? 14.231 24.460 41.678 1.00 13.22 ? 49 THR A C 1 5: ATOM 377 O O . THR A 1 49 ? 15.235 24.152 42.322 1.00 12.56 ? 49 THR A O 1 5: ATOM 378 C CB . THR A 1 49 ? 12.847 25.741 43.316 1.00 16.10 ? 49 THR A CB 1 5: ATOM 379 O OG1 . THR A 1 49 ? 11.556 25.815 43.941 1.00 17.94 ? 49 THR A OG1 1 5: ATOM 380 C CG2 . THR A 1 49 ? 13.100 27.037 42.571 1.00 16.15 ? 49 THR A CG2 1 5: ATOM 381 N N . PHE A 1 50 ? 14.266 24.794 40.392 1.00 12.20 ? 50 PHE A N 1 5: ATOM 382 C CA . PHE A 1 50 ? 15.485 24.704 39.602 1.00 10.82 ? 50 PHE A CA 1 5: ATOM 383 C C . PHE A 1 50 ? 15.842 25.979 38.855 1.00 10.40 ? 50 PHE A C 1 5: ATOM 384 O O . PHE A 1 50 ? 14.968 26.758 38.460 1.00 9.90 ? 50 PHE A O 1 5: ATOM 385 C CB . PHE A 1 50 ? 15.338 23.591 38.547 1.00 10.78 ? 50 PHE A CB 1 5: ATOM 386 C CG . PHE A 1 50 ? 15.316 22.192 39.107 1.00 13.13 ? 50 PHE A CG 1 5: ATOM 387 C CD1 . PHE A 1 50 ? 14.146 21.653 39.634 1.00 11.97 ? 50 PHE A CD1 1 5: ATOM 388 C CD2 . PHE A 1 50 ? 16.464 21.401 39.079 1.00 14.34 ? 50 PHE A CD2 1 5: ATOM 389 C CE1 . PHE A 1 50 ? 14.113 20.367 40.120 1.00 12.69 ? 50 PHE A CE1 1 5: ATOM 390 C CE2 . PHE A 1 50 ? 16.439 20.098 39.569 1.00 14.64 ? 50 PHE A CE2 1 5: ATOM 391 C CZ . PHE A 1 50 ? 15.258 19.582 40.092 1.00 13.15 ? 50 PHE A CZ 1 5: ATOM 392 N N . TYR A 1 51 ? 17.147 26.165 38.678 1.00 10.37 ? 51 TYR A N 1 5: ATOM 393 C CA . TYR A 1 51 ? 17.709 27.258 37.910 1.00 10.95 ? 51 TYR A CA 1 5: ATOM 394 C C . TYR A 1 51 ? 18.714 26.513 37.039 1.00 9.84 ? 51 TYR A C 1 5: ATOM 395 O O . TYR A 1 51 ? 19.540 25.761 37.547 1.00 9.78 ? 51 TYR A O 1 5: ATOM 396 C CB . TYR A 1 51 ? 18.436 28.284 38.790 1.00 12.57 ? 51 TYR A CB 1 5: ATOM 397 C CG . TYR A 1 51 ? 19.396 29.178 38.014 1.00 12.91 ? 51 TYR A CG 1 5: ATOM 398 C CD1 . TYR A 1 51 ? 18.939 30.302 37.327 1.00 15.83 ? 51 TYR A CD1 1 5: ATOM 399 C CD2 . TYR A 1 51 ? 20.762 28.896 37.974 1.00 14.05 ? 51 TYR A CD2 1 5: ATOM 400 C CE1 . TYR A 1 51 ? 19.822 31.126 36.621 1.00 16.52 ? 51 TYR A CE1 1 5: ATOM 401 C CE2 . TYR A 1 51 ? 21.655 29.705 37.275 1.00 14.62 ? 51 TYR A CE2 1 5: ATOM 402 C CZ . TYR A 1 51 ? 21.179 30.818 36.604 1.00 16.59 ? 51 TYR A CZ 1 5: ATOM 403 O OH . TYR A 1 51 ? 22.060 31.633 35.932 1.00 17.52 ? 51 TYR A OH 1 5: ATOM 404 N N . ILE A 1 52 ? 18.610 26.676 35.726 1.00 10.57 ? 52 ILE A N 1 5: ATOM 405 C CA . ILE A 1 52 ? 19.520 26.004 34.801 1.00 9.09 ? 52 ILE A CA 1 5: ATOM 406 C C . ILE A 1 52 ? 20.066 27.020 33.801 1.00 8.55 ? 52 ILE A C 1 5: ATOM 407 O O . ILE A 1 52 ? 19.296 27.652 33.086 1.00 10.49 ? 52 ILE A O 1 5: ATOM 408 C CB . ILE A 1 52 ? 18.807 24.859 34.026 1.00 8.96 ? 52 ILE A CB 1 5: ATOM 409 C CG1 . ILE A 1 52 ? 18.242 23.814 35.013 1.00 9.15 ? 52 ILE A CG1 1 5: ATOM 410 C CG2 . ILE A 1 52 ? 19.792 24.189 33.070 1.00 10.39 ? 52 ILE A CG2 1 5: ATOM 411 C CD1 . ILE A 1 52 ? 17.585 22.616 34.366 1.00 8.10 ? 52 ILE A CD1 1 5: ATOM 412 N N . LYS A 1 53 ? 21.388 27.197 33.791 1.00 8.61 ? 53 LYS A N 1 5: ATOM 413 C CA . LYS A 1 53 ? 22.049 28.115 32.868 1.00 9.66 ? 53 LYS A CA 1 5: ATOM 414 C C . LYS A 1 53 ? 22.939 27.319 31.924 1.00 8.71 ? 53 LYS A C 1 5: ATOM 415 O O . LYS A 1 53 ? 23.815 26.583 32.362 1.00 7.58 ? 53 LYS A O 1 5: ATOM 416 C CB . LYS A 1 53 ? 22.909 29.120 33.611 1.00 10.60 ? 53 LYS A CB 1 5: ATOM 417 C CG . LYS A 1 53 ? 23.580 30.135 32.688 1.00 14.21 ? 53 LYS A CG 1 5: ATOM 418 C CD . LYS A 1 53 ? 24.496 31.006 33.505 1.00 20.27 ? 53 LYS A CD 1 5: ATOM 419 C CE . LYS A 1 53 ? 24.831 32.319 32.828 1.00 26.91 ? 53 LYS A CE 1 5: ATOM 420 N NZ . LYS A 1 53 ? 25.878 33.009 33.659 1.00 29.12 ? 53 LYS A NZ 1 5: ATOM 421 N N . THR A 1 54 ? 22.686 27.445 30.625 1.00 8.49 ? 54 THR A N 1 5: ATOM 422 C CA . THR A 1 54 ? 23.478 26.747 29.628 1.00 7.98 ? 54 THR A CA 1 5: ATOM 423 C C . THR A 1 54 ? 24.118 27.820 28.764 1.00 8.23 ? 54 THR A C 1 5: ATOM 424 O O . THR A 1 54 ? 23.433 28.584 28.087 1.00 8.40 ? 54 THR A O 1 5: ATOM 425 C CB . THR A 1 54 ? 22.621 25.817 28.789 1.00 8.33 ? 54 THR A CB 1 5: ATOM 426 O OG1 . THR A 1 54 ? 21.896 24.946 29.660 1.00 9.95 ? 54 THR A OG1 1 5: ATOM 427 C CG2 . THR A 1 54 ? 23.505 24.976 27.873 1.00 4.95 ? 54 THR A CG2 1 5: ATOM 428 N N . SER A 1 55 ? 25.444 27.840 28.758 1.00 8.75 ? 55 SER A N 1 5: ATOM 429 C CA . SER A 1 55 ? 26.171 28.865 28.047 1.00 10.50 ? 55 SER A CA 1 5: ATOM 430 C C . SER A 1 55 ? 27.116 28.382 26.950 1.00 9.24 ? 55 SER A C 1 5: ATOM 431 O O . SER A 1 55 ? 27.802 27.370 27.101 1.00 8.98 ? 55 SER A O 1 5: ATOM 432 C CB . SER A 1 55 ? 26.934 29.694 29.082 1.00 13.09 ? 55 SER A CB 1 5: ATOM 433 O OG . SER A 1 55 ? 27.781 30.646 28.473 1.00 23.11 ? 55 SER A OG 1 5: ATOM 434 N N . THR A 1 56 ? 27.091 29.094 25.825 1.00 8.86 ? 56 THR A N 1 5: ATOM 435 C CA . THR A 1 56 ? 27.978 28.831 24.684 1.00 8.05 ? 56 THR A CA 1 5: ATOM 436 C C . THR A 1 56 ? 28.393 30.215 24.138 1.00 8.09 ? 56 THR A C 1 5: ATOM 437 O O . THR A 1 56 ? 27.834 31.237 24.525 1.00 7.17 ? 56 THR A O 1 5: ATOM 438 C CB . THR A 1 56 ? 27.296 28.024 23.534 1.00 6.70 ? 56 THR A CB 1 5: ATOM 439 O OG1 . THR A 1 56 ? 26.294 28.829 22.909 1.00 9.76 ? 56 THR A OG1 1 5: ATOM 440 C CG2 . THR A 1 56 ? 26.653 26.751 24.049 1.00 7.76 ? 56 THR A CG2 1 5: ATOM 441 N N . THR A 1 57 ? 29.381 30.242 23.249 1.00 9.17 ? 57 THR A N 1 5: ATOM 442 C CA . THR A 1 57 ? 29.871 31.485 22.644 1.00 8.49 ? 57 THR A CA 1 5: ATOM 443 C C . THR A 1 57 ? 28.820 32.222 21.802 1.00 7.50 ? 57 THR A C 1 5: ATOM 444 O O . THR A 1 57 ? 28.952 33.412 21.565 1.00 9.40 ? 57 THR A O 1 5: ATOM 445 C CB . THR A 1 57 ? 31.091 31.205 21.716 1.00 9.12 ? 57 THR A CB 1 5: ATOM 446 O OG1 . THR A 1 57 ? 30.758 30.171 20.786 1.00 9.41 ? 57 THR A OG1 1 5: ATOM 447 C CG2 . THR A 1 57 ? 32.297 30.775 22.516 1.00 11.48 ? 57 THR A CG2 1 5: ATOM 448 N N . VAL A 1 58 ? 27.786 31.510 21.356 1.00 8.04 ? 58 VAL A N 1 5: ATOM 449 C CA . VAL A 1 58 ? 26.733 32.090 20.500 1.00 9.09 ? 58 VAL A CA 1 5: ATOM 450 C C . VAL A 1 58 ? 25.328 32.224 21.102 1.00 8.67 ? 58 VAL A C 1 5: ATOM 451 O O . VAL A 1 58 ? 24.466 32.892 20.531 1.00 6.97 ? 58 VAL A O 1 5: ATOM 452 C CB . VAL A 1 58 ? 26.602 31.287 19.155 1.00 9.96 ? 58 VAL A CB 1 5: ATOM 453 C CG1 . VAL A 1 58 ? 27.976 31.161 18.454 1.00 11.08 ? 58 VAL A CG1 1 5: ATOM 454 C CG2 . VAL A 1 58 ? 26.010 29.890 19.404 1.00 9.41 ? 58 VAL A CG2 1 5: ATOM 455 N N . ARG A 1 59 ? 25.100 31.620 22.266 1.00 8.88 ? 59 ARG A N 1 5: ATOM 456 C CA . ARG A 1 59 ? 23.783 31.655 22.882 1.00 9.95 ? 59 ARG A CA 1 5: ATOM 457 C C . ARG A 1 59 ? 23.843 31.140 24.303 1.00 10.14 ? 59 ARG A C 1 5: ATOM 458 O O . ARG A 1 59 ? 24.440 30.108 24.556 1.00 10.10 ? 59 ARG A O 1 5: ATOM 459 C CB . ARG A 1 59 ? 22.837 30.751 22.074 1.00 13.11 ? 59 ARG A CB 1 5: ATOM 460 C CG . ARG A 1 59 ? 21.417 30.569 22.623 1.00 16.80 ? 59 ARG A CG 1 5: ATOM 461 C CD . ARG A 1 59 ? 20.521 29.961 21.535 1.00 18.74 ? 59 ARG A CD 1 5: ATOM 462 N NE . ARG A 1 59 ? 19.250 29.440 22.032 1.00 20.63 ? 59 ARG A NE 1 5: ATOM 463 C CZ . ARG A 1 59 ? 18.147 30.165 22.193 1.00 22.94 ? 59 ARG A CZ 1 5: ATOM 464 N NH1 . ARG A 1 59 ? 18.138 31.462 21.894 1.00 22.55 ? 59 ARG A NH1 1 5: ATOM 465 N NH2 . ARG A 1 59 ? 17.051 29.594 22.686 1.00 23.68 ? 59 ARG A NH2 1 5: ATOM 466 N N . THR A 1 60 ? 23.183 31.849 25.211 1.00 11.23 ? 60 THR A N 1 5: ATOM 467 C CA . THR A 1 60 ? 23.120 31.458 26.611 1.00 11.84 ? 60 THR A CA 1 5: ATOM 468 C C . THR A 1 60 ? 21.650 31.500 27.005 1.00 11.73 ? 60 THR A C 1 5: ATOM 469 O O . THR A 1 60 ? 20.934 32.423 26.620 1.00 13.69 ? 60 THR A O 1 5: ATOM 470 C CB . THR A 1 60 ? 23.916 32.451 27.519 1.00 10.13 ? 60 THR A CB 1 5: ATOM 471 O OG1 . THR A 1 60 ? 25.320 32.302 27.276 1.00 10.55 ? 60 THR A OG1 1 5: ATOM 472 C CG2 . THR A 1 60 ? 23.632 32.181 29.003 1.00 11.01 ? 60 THR A CG2 1 5: ATOM 473 N N . THR A 1 61 ? 21.183 30.470 27.706 1.00 11.78 ? 61 THR A N 1 5: ATOM 474 C CA . THR A 1 61 ? 19.797 30.413 28.175 1.00 11.54 ? 61 THR A CA 1 5: ATOM 475 C C . THR A 1 61 ? 19.831 30.214 29.686 1.00 10.88 ? 61 THR A C 1 5: ATOM 476 O O . THR A 1 61 ? 20.734 29.570 30.205 1.00 9.63 ? 61 THR A O 1 5: ATOM 477 C CB . THR A 1 61 ? 18.965 29.229 27.539 1.00 12.65 ? 61 THR A CB 1 5: ATOM 478 O OG1 . THR A 1 61 ? 19.563 27.976 27.874 1.00 14.13 ? 61 THR A OG1 1 5: ATOM 479 C CG2 . THR A 1 61 ? 18.889 29.336 26.012 1.00 14.15 ? 61 THR A CG2 1 5: ATOM 480 N N . GLU A 1 62 ? 18.878 30.828 30.382 1.00 12.14 ? 62 GLU A N 1 5: ATOM 481 C CA . GLU A 1 62 ? 18.749 30.698 31.833 1.00 12.88 ? 62 GLU A CA 1 5: ATOM 482 C C . GLU A 1 62 ? 17.283 30.444 32.100 1.00 12.21 ? 62 GLU A C 1 5: ATOM 483 O O . GLU A 1 62 ? 16.450 31.270 31.745 1.00 13.95 ? 62 GLU A O 1 5: ATOM 484 C CB . GLU A 1 62 ? 19.151 31.990 32.538 1.00 16.15 ? 62 GLU A CB 1 5: ATOM 485 C CG . GLU A 1 62 ? 20.585 32.344 32.326 1.00 23.65 ? 62 GLU A CG 1 5: ATOM 486 C CD . GLU A 1 62 ? 20.961 33.649 32.979 1.00 29.90 ? 62 GLU A CD 1 5: ATOM 487 O OE1 . GLU A 1 62 ? 20.969 33.703 34.229 1.00 31.84 ? 62 GLU A OE1 1 5: ATOM 488 O OE2 . GLU A 1 62 ? 21.258 34.616 32.236 1.00 33.89 ? 62 GLU A OE2 1 5: ATOM 489 N N . ILE A 1 63 ? 16.943 29.292 32.657 1.00 10.43 ? 63 ILE A N 1 5: ATOM 490 C CA . ILE A 1 63 ? 15.548 29.021 32.946 1.00 11.02 ? 63 ILE A CA 1 5: ATOM 491 C C . ILE A 1 63 ? 15.352 28.816 34.446 1.00 11.60 ? 63 ILE A C 1 5: ATOM 492 O O . ILE A 1 63 ? 16.286 28.434 35.144 1.00 9.20 ? 63 ILE A O 1 5: ATOM 493 C CB . ILE A 1 63 ? 14.976 27.816 32.125 1.00 11.28 ? 63 ILE A CB 1 5: ATOM 494 C CG1 . ILE A 1 63 ? 15.717 26.519 32.431 1.00 10.60 ? 63 ILE A CG1 1 5: ATOM 495 C CG2 . ILE A 1 63 ? 15.020 28.129 30.638 1.00 11.62 ? 63 ILE A CG2 1 5: ATOM 496 C CD1 . ILE A 1 63 ? 15.126 25.293 31.720 1.00 13.40 ? 63 ILE A CD1 1 5: ATOM 497 N N . ASN A 1 64 ? 14.184 29.219 34.933 1.00 12.13 ? 64 ASN A N 1 5: ATOM 498 C CA . ASN A 1 64 ? 13.824 29.083 36.343 1.00 14.79 ? 64 ASN A CA 1 5: ATOM 499 C C . ASN A 1 64 ? 12.451 28.441 36.375 1.00 13.29 ? 64 ASN A C 1 5: ATOM 500 O O . ASN A 1 64 ? 11.490 28.976 35.802 1.00 13.29 ? 64 ASN A O 1 5: ATOM 501 C CB . ASN A 1 64 ? 13.732 30.450 37.054 1.00 16.87 ? 64 ASN A CB 1 5: ATOM 502 C CG . ASN A 1 64 ? 15.079 31.089 37.279 1.00 20.91 ? 64 ASN A CG 1 5: ATOM 503 O OD1 . ASN A 1 64 ? 15.775 30.764 38.238 1.00 22.91 ? 64 ASN A OD1 1 5: ATOM 504 N ND2 . ASN A 1 64 ? 15.459 32.007 36.393 1.00 22.20 ? 64 ASN A ND2 1 5: ATOM 505 N N . PHE A 1 65 ? 12.347 27.301 37.044 1.00 12.90 ? 65 PHE A N 1 5: ATOM 506 C CA . PHE A 1 65 ? 11.058 26.641 37.132 1.00 12.63 ? 65 PHE A CA 1 5: ATOM 507 C C . PHE A 1 65 ? 10.858 25.841 38.410 1.00 13.07 ? 65 PHE A C 1 5: ATOM 508 O O . PHE A 1 65 ? 11.811 25.531 39.121 1.00 12.50 ? 65 PHE A O 1 5: ATOM 509 C CB . PHE A 1 65 ? 10.829 25.731 35.922 1.00 11.31 ? 65 PHE A CB 1 5: ATOM 510 C CG . PHE A 1 65 ? 11.794 24.586 35.825 1.00 12.32 ? 65 PHE A CG 1 5: ATOM 511 C CD1 . PHE A 1 65 ? 11.549 23.386 36.494 1.00 10.31 ? 65 PHE A CD1 1 5: ATOM 512 C CD2 . PHE A 1 65 ? 12.947 24.706 35.070 1.00 11.23 ? 65 PHE A CD2 1 5: ATOM 513 C CE1 . PHE A 1 65 ? 12.441 22.329 36.413 1.00 11.00 ? 65 PHE A CE1 1 5: ATOM 514 C CE2 . PHE A 1 65 ? 13.847 23.645 34.984 1.00 11.69 ? 65 PHE A CE2 1 5: ATOM 515 C CZ . PHE A 1 65 ? 13.593 22.461 35.655 1.00 12.20 ? 65 PHE A CZ 1 5: ATOM 516 N N . LYS A 1 66 ? 9.599 25.560 38.713 1.00 13.15 ? 66 LYS A N 1 5: ATOM 517 C CA . LYS A 1 66 ? 9.251 24.735 39.849 1.00 13.41 ? 66 LYS A CA 1 5: ATOM 518 C C . LYS A 1 66 ? 8.555 23.552 39.178 1.00 12.17 ? 66 LYS A C 1 5: ATOM 519 O O . LYS A 1 66 ? 7.763 23.747 38.251 1.00 12.93 ? 66 LYS A O 1 5: ATOM 520 C CB . LYS A 1 66 ? 8.313 25.498 40.800 1.00 16.68 ? 66 LYS A CB 1 5: ATOM 521 C CG . LYS A 1 66 ? 7.722 24.639 41.907 1.00 24.60 ? 66 LYS A CG 1 5: ATOM 522 C CD . LYS A 1 66 ? 7.391 25.453 43.165 1.00 28.53 ? 66 LYS A CD 1 5: ATOM 523 C CE . LYS A 1 66 ? 6.664 24.585 44.213 1.00 32.17 ? 66 LYS A CE 1 5: ATOM 524 N NZ . LYS A 1 66 ? 7.393 23.332 44.604 1.00 32.54 ? 66 LYS A NZ 1 5: ATOM 525 N N . VAL A 1 67 ? 8.918 22.329 39.562 1.00 11.82 ? 67 VAL A N 1 5: ATOM 526 C CA . VAL A 1 67 ? 8.295 21.141 38.975 1.00 10.93 ? 67 VAL A CA 1 5: ATOM 527 C C . VAL A 1 67 ? 6.783 21.174 39.226 1.00 11.97 ? 67 VAL A C 1 5: ATOM 528 O O . VAL A 1 67 ? 6.343 21.480 40.342 1.00 13.54 ? 67 VAL A O 1 5: ATOM 529 C CB . VAL A 1 67 ? 8.908 19.827 39.541 1.00 10.09 ? 67 VAL A CB 1 5: ATOM 530 C CG1 . VAL A 1 67 ? 8.271 18.617 38.883 1.00 10.96 ? 67 VAL A CG1 1 5: ATOM 531 C CG2 . VAL A 1 67 ? 10.410 19.808 39.320 1.00 10.21 ? 67 VAL A CG2 1 5: ATOM 532 N N . GLY A 1 68 ? 6.006 20.965 38.160 1.00 9.80 ? 68 GLY A N 1 5: ATOM 533 C CA . GLY A 1 68 ? 4.557 20.962 38.265 1.00 9.33 ? 68 GLY A CA 1 5: ATOM 534 C C . GLY A 1 68 ? 3.887 22.298 38.031 1.00 10.60 ? 68 GLY A C 1 5: ATOM 535 O O . GLY A 1 68 ? 2.653 22.389 38.039 1.00 11.93 ? 68 GLY A O 1 5: ATOM 536 N N . GLU A 1 69 ? 4.688 23.337 37.809 1.00 11.12 ? 69 GLU A N 1 5: ATOM 537 C CA . GLU A 1 69 ? 4.165 24.682 37.553 1.00 12.64 ? 69 GLU A CA 1 5: ATOM 538 C C . GLU A 1 69 ? 4.604 25.185 36.184 1.00 13.09 ? 69 GLU A C 1 5: ATOM 539 O O . GLU A 1 69 ? 5.774 25.107 35.820 1.00 12.17 ? 69 GLU A O 1 5: ATOM 540 C CB . GLU A 1 69 ? 4.578 25.642 38.668 1.00 12.20 ? 69 GLU A CB 1 5: ATOM 541 C CG . GLU A 1 69 ? 3.857 25.282 39.964 1.00 17.44 ? 69 GLU A CG 1 5: ATOM 542 C CD . GLU A 1 69 ? 4.116 26.211 41.138 1.00 21.02 ? 69 GLU A CD 1 5: ATOM 543 O OE1 . GLU A 1 69 ? 4.496 27.384 40.945 1.00 21.43 ? 69 GLU A OE1 1 5: ATOM 544 O OE2 . GLU A 1 69 ? 3.902 25.753 42.282 1.00 23.44 ? 69 GLU A OE2 1 5: ATOM 545 N N . GLU A 1 70 ? 3.633 25.622 35.397 1.00 14.53 ? 70 GLU A N 1 5: ATOM 546 C CA . GLU A 1 70 ? 3.912 26.102 34.059 1.00 15.80 ? 70 GLU A CA 1 5: ATOM 547 C C . GLU A 1 70 ? 4.816 27.329 34.007 1.00 13.72 ? 70 GLU A C 1 5: ATOM 548 O O . GLU A 1 70 ? 4.761 28.208 34.863 1.00 13.66 ? 70 GLU A O 1 5: ATOM 549 C CB . GLU A 1 70 ? 2.606 26.359 33.320 1.00 19.99 ? 70 GLU A CB 1 5: ATOM 550 C CG . GLU A 1 70 ? 2.814 26.634 31.851 1.00 28.23 ? 70 GLU A CG 1 5: ATOM 551 C CD . GLU A 1 70 ? 1.518 26.678 31.097 1.00 32.73 ? 70 GLU A CD 1 5: ATOM 552 O OE1 . GLU A 1 70 ? 0.975 25.589 30.789 1.00 35.76 ? 70 GLU A OE1 1 5: ATOM 553 O OE2 . GLU A 1 70 ? 1.045 27.802 30.823 1.00 35.75 ? 70 GLU A OE2 1 5: ATOM 554 N N . PHE A 1 71 ? 5.713 27.340 33.028 1.00 12.80 ? 71 PHE A N 1 5: ATOM 555 C CA . PHE A 1 71 ? 6.638 28.448 32.837 1.00 12.36 ? 71 PHE A CA 1 5: ATOM 556 C C . PHE A 1 71 ? 6.856 28.678 31.350 1.00 12.97 ? 71 PHE A C 1 5: ATOM 557 O O . PHE A 1 71 ? 6.382 27.917 30.516 1.00 12.54 ? 71 PHE A O 1 5: ATOM 558 C CB . PHE A 1 71 ? 7.975 28.243 33.589 1.00 10.02 ? 71 PHE A CB 1 5: ATOM 559 C CG . PHE A 1 71 ? 8.851 27.148 33.033 1.00 10.48 ? 71 PHE A CG 1 5: ATOM 560 C CD1 . PHE A 1 71 ? 8.549 25.815 33.256 1.00 9.95 ? 71 PHE A CD1 1 5: ATOM 561 C CD2 . PHE A 1 71 ? 10.006 27.459 32.331 1.00 9.29 ? 71 PHE A CD2 1 5: ATOM 562 C CE1 . PHE A 1 71 ? 9.380 24.811 32.793 1.00 9.74 ? 71 PHE A CE1 1 5: ATOM 563 C CE2 . PHE A 1 71 ? 10.832 26.464 31.868 1.00 9.51 ? 71 PHE A CE2 1 5: ATOM 564 C CZ . PHE A 1 71 ? 10.518 25.136 32.102 1.00 8.47 ? 71 PHE A CZ 1 5: ATOM 565 N N . GLU A 1 72 ? 7.581 29.733 31.028 1.00 15.04 ? 72 GLU A N 1 5: ATOM 566 C CA . GLU A 1 72 ? 7.826 30.063 29.644 1.00 17.19 ? 72 GLU A CA 1 5: ATOM 567 C C . GLU A 1 72 ? 9.323 30.036 29.357 1.00 15.53 ? 72 GLU A C 1 5: ATOM 568 O O . GLU A 1 72 ? 10.130 30.511 30.158 1.00 16.16 ? 72 GLU A O 1 5: ATOM 569 C CB . GLU A 1 72 ? 7.248 31.448 29.379 1.00 22.03 ? 72 GLU A CB 1 5: ATOM 570 C CG . GLU A 1 72 ? 6.700 31.658 28.002 1.00 30.80 ? 72 GLU A CG 1 5: ATOM 571 C CD . GLU A 1 72 ? 6.157 33.060 27.827 1.00 34.75 ? 72 GLU A CD 1 5: ATOM 572 O OE1 . GLU A 1 72 ? 5.014 33.309 28.276 1.00 35.88 ? 72 GLU A OE1 1 5: ATOM 573 O OE2 . GLU A 1 72 ? 6.885 33.912 27.255 1.00 38.91 ? 72 GLU A OE2 1 5: ATOM 574 N N . GLU A 1 73 ? 9.691 29.378 28.263 1.00 13.46 ? 73 GLU A N 1 5: ATOM 575 C CA . GLU A 1 73 ? 11.088 29.302 27.836 1.00 13.89 ? 73 GLU A CA 1 5: ATOM 576 C C . GLU A 1 73 ? 11.083 29.318 26.301 1.00 13.70 ? 73 GLU A C 1 5: ATOM 577 O O . GLU A 1 73 ? 10.159 29.859 25.690 1.00 13.63 ? 73 GLU A O 1 5: ATOM 578 C CB . GLU A 1 73 ? 11.780 28.032 28.379 1.00 12.63 ? 73 GLU A CB 1 5: ATOM 579 C CG . GLU A 1 73 ? 11.145 26.706 27.986 1.00 10.55 ? 73 GLU A CG 1 5: ATOM 580 C CD . GLU A 1 73 ? 11.997 25.499 28.366 1.00 8.94 ? 73 GLU A CD 1 5: ATOM 581 O OE1 . GLU A 1 73 ? 13.191 25.650 28.642 1.00 12.29 ? 73 GLU A OE1 1 5: ATOM 582 O OE2 . GLU A 1 73 ? 11.485 24.374 28.363 1.00 10.37 ? 73 GLU A OE2 1 5: ATOM 583 N N . GLN A 1 74 ? 12.115 28.751 25.685 1.00 13.09 ? 74 GLN A N 1 5: ATOM 584 C CA . GLN A 1 74 ? 12.187 28.691 24.239 1.00 13.16 ? 74 GLN A CA 1 5: ATOM 585 C C . GLN A 1 74 ? 12.618 27.315 23.806 1.00 12.86 ? 74 GLN A C 1 5: ATOM 586 O O . GLN A 1 74 ? 13.290 26.596 24.552 1.00 13.17 ? 74 GLN A O 1 5: ATOM 587 C CB . GLN A 1 74 ? 13.218 29.685 23.706 1.00 15.91 ? 74 GLN A CB 1 5: ATOM 588 C CG . GLN A 1 74 ? 12.803 31.133 23.779 1.00 19.68 ? 74 GLN A CG 1 5: ATOM 589 C CD . GLN A 1 74 ? 13.827 32.066 23.159 1.00 21.00 ? 74 GLN A CD 1 5: ATOM 590 O OE1 . GLN A 1 74 ? 15.010 31.730 23.024 1.00 22.37 ? 74 GLN A OE1 1 5: ATOM 591 N NE2 . GLN A 1 74 ? 13.373 33.247 22.774 1.00 24.07 ? 74 GLN A NE2 1 5: ATOM 592 N N . THR A 1 75 ? 12.229 26.935 22.600 1.00 10.98 ? 75 THR A N 1 5: ATOM 593 C CA . THR A 1 75 ? 12.664 25.656 22.056 1.00 11.83 ? 75 THR A CA 1 5: ATOM 594 C C . THR A 1 75 ? 14.162 25.828 21.729 1.00 11.24 ? 75 THR A C 1 5: ATOM 595 O O . THR A 1 75 ? 14.681 26.951 21.764 1.00 9.95 ? 75 THR A O 1 5: ATOM 596 C CB . THR A 1 75 ? 11.895 25.325 20.757 1.00 11.93 ? 75 THR A CB 1 5: ATOM 597 O OG1 . THR A 1 75 ? 12.123 26.366 19.795 1.00 13.31 ? 75 THR A OG1 1 5: ATOM 598 C CG2 . THR A 1 75 ? 10.396 25.202 21.042 1.00 13.29 ? 75 THR A CG2 1 5: ATOM 599 N N . VAL A 1 76 ? 14.841 24.731 21.377 1.00 13.77 ? 76 VAL A N 1 5: ATOM 600 C CA . VAL A 1 76 ? 16.278 24.762 21.049 1.00 14.39 ? 76 VAL A CA 1 5: ATOM 601 C C . VAL A 1 76 ? 16.612 25.734 19.914 1.00 12.97 ? 76 VAL A C 1 5: ATOM 602 O O . VAL A 1 76 ? 17.639 26.407 19.956 1.00 13.75 ? 76 VAL A O 1 5: ATOM 603 C CB . VAL A 1 76 ? 16.827 23.351 20.680 1.00 15.44 ? 76 VAL A CB 1 5: ATOM 604 C CG1 . VAL A 1 76 ? 18.332 23.314 20.844 1.00 17.74 ? 76 VAL A CG1 1 5: ATOM 605 C CG2 . VAL A 1 76 ? 16.218 22.293 21.548 1.00 19.99 ? 76 VAL A CG2 1 5: ATOM 606 N N . ASP A 1 77 ? 15.730 25.824 18.921 1.00 13.67 ? 77 ASP A N 1 5: ATOM 607 C CA . ASP A 1 77 ? 15.933 26.727 17.789 1.00 14.47 ? 77 ASP A CA 1 5: ATOM 608 C C . ASP A 1 77 ? 15.486 28.172 18.061 1.00 15.23 ? 77 ASP A C 1 5: ATOM 609 O O . ASP A 1 77 ? 15.461 29.002 17.153 1.00 14.90 ? 77 ASP A O 1 5: ATOM 610 C CB . ASP A 1 77 ? 15.301 26.158 16.503 1.00 15.63 ? 77 ASP A CB 1 5: ATOM 611 C CG . ASP A 1 77 ? 13.790 26.007 16.585 1.00 15.92 ? 77 ASP A CG 1 5: ATOM 612 O OD1 . ASP A 1 77 ? 13.260 25.470 17.586 1.00 14.64 ? 77 ASP A OD1 1 5: ATOM 613 O OD2 . ASP A 1 77 ? 13.123 26.409 15.613 1.00 17.79 ? 77 ASP A OD2 1 5: ATOM 614 N N . GLY A 1 78 ? 15.095 28.445 19.312 1.00 15.17 ? 78 GLY A N 1 5: ATOM 615 C CA . GLY A 1 78 ? 14.709 29.790 19.726 1.00 15.90 ? 78 GLY A CA 1 5: ATOM 616 C C . GLY A 1 78 ? 13.268 30.281 19.701 1.00 16.89 ? 78 GLY A C 1 5: ATOM 617 O O . GLY A 1 78 ? 13.038 31.489 19.790 1.00 19.37 ? 78 GLY A O 1 5: ATOM 618 N N . ARG A 1 79 ? 12.292 29.389 19.620 1.00 16.76 ? 79 ARG A N 1 5: ATOM 619 C CA . ARG A 1 79 ? 10.896 29.822 19.587 1.00 18.08 ? 79 ARG A CA 1 5: ATOM 620 C C . ARG A 1 79 ? 10.229 29.768 20.961 1.00 16.55 ? 79 ARG A C 1 5: ATOM 621 O O . ARG A 1 79 ? 10.379 28.787 21.680 1.00 16.57 ? 79 ARG A O 1 5: ATOM 622 C CB . ARG A 1 79 ? 10.112 28.961 18.604 1.00 20.74 ? 79 ARG A CB 1 5: ATOM 623 C CG . ARG A 1 79 ? 10.667 28.997 17.194 1.00 25.89 ? 79 ARG A CG 1 5: ATOM 624 C CD . ARG A 1 79 ? 9.986 27.976 16.310 1.00 29.77 ? 79 ARG A CD 1 5: ATOM 625 N NE . ARG A 1 79 ? 10.144 26.626 16.842 1.00 34.52 ? 79 ARG A NE 1 5: ATOM 626 C CZ . ARG A 1 79 ? 10.128 25.516 16.109 1.00 35.90 ? 79 ARG A CZ 1 5: ATOM 627 N NH1 . ARG A 1 79 ? 9.971 25.580 14.789 1.00 37.70 ? 79 ARG A NH1 1 5: ATOM 628 N NH2 . ARG A 1 79 ? 10.266 24.337 16.702 1.00 35.58 ? 79 ARG A NH2 1 5: ATOM 629 N N . PRO A 1 80 ? 9.501 30.830 21.352 1.00 15.98 ? 80 PRO A N 1 5: ATOM 630 C CA . PRO A 1 80 ? 8.819 30.867 22.651 1.00 15.47 ? 80 PRO A CA 1 5: ATOM 631 C C . PRO A 1 80 ? 7.825 29.725 22.833 1.00 14.23 ? 80 PRO A C 1 5: ATOM 632 O O . PRO A 1 80 ? 7.058 29.393 21.926 1.00 14.56 ? 80 PRO A O 1 5: ATOM 633 C CB . PRO A 1 80 ? 8.100 32.220 22.628 1.00 15.48 ? 80 PRO A CB 1 5: ATOM 634 C CG . PRO A 1 80 ? 9.010 33.057 21.846 1.00 18.18 ? 80 PRO A CG 1 5: ATOM 635 C CD . PRO A 1 80 ? 9.418 32.145 20.696 1.00 17.08 ? 80 PRO A CD 1 5: ATOM 636 N N . CYS A 1 81 ? 7.817 29.148 24.028 1.00 13.52 ? 81 CYS A N 1 5: ATOM 637 C CA . CYS A 1 81 ? 6.914 28.055 24.331 1.00 12.41 ? 81 CYS A CA 1 5: ATOM 638 C C . CYS A 1 81 ? 6.548 28.054 25.811 1.00 12.52 ? 81 CYS A C 1 5: ATOM 639 O O . CYS A 1 81 ? 7.202 28.718 26.624 1.00 11.74 ? 81 CYS A O 1 5: ATOM 640 C CB . CYS A 1 81 ? 7.563 26.705 23.950 1.00 11.59 ? 81 CYS A CB 1 5: ATOM 641 S SG . CYS A 1 81 ? 9.063 26.255 24.894 1.00 12.86 ? 81 CYS A SG 1 5: ATOM 642 N N . LYS A 1 82 ? 5.448 27.379 26.121 1.00 13.86 ? 82 LYS A N 1 5: ATOM 643 C CA . LYS A 1 82 ? 4.988 27.197 27.492 1.00 14.38 ? 82 LYS A CA 1 5: ATOM 644 C C . LYS A 1 82 ? 5.436 25.779 27.839 1.00 13.51 ? 82 LYS A C 1 5: ATOM 645 O O . LYS A 1 82 ? 5.227 24.842 27.063 1.00 12.69 ? 82 LYS A O 1 5: ATOM 646 C CB . LYS A 1 82 ? 3.473 27.299 27.589 1.00 18.36 ? 82 LYS A CB 1 5: ATOM 647 C CG . LYS A 1 82 ? 2.940 28.716 27.584 1.00 26.02 ? 82 LYS A CG 1 5: ATOM 648 C CD . LYS A 1 82 ? 3.353 29.506 28.826 1.00 31.13 ? 82 LYS A CD 1 5: ATOM 649 C CE . LYS A 1 82 ? 2.686 30.894 28.832 1.00 35.39 ? 82 LYS A CE 1 5: ATOM 650 N NZ . LYS A 1 82 ? 2.868 31.652 30.120 1.00 37.63 ? 82 LYS A NZ 1 5: ATOM 651 N N . SER A 1 83 ? 6.110 25.638 28.974 1.00 11.15 ? 83 SER A N 1 5: ATOM 652 C CA . SER A 1 83 ? 6.624 24.352 29.397 1.00 10.10 ? 83 SER A CA 1 5: ATOM 653 C C . SER A 1 83 ? 6.083 23.931 30.752 1.00 11.16 ? 83 SER A C 1 5: ATOM 654 O O . SER A 1 83 ? 5.721 24.769 31.575 1.00 10.21 ? 83 SER A O 1 5: ATOM 655 C CB . SER A 1 83 ? 8.149 24.418 29.446 1.00 10.30 ? 83 SER A CB 1 5: ATOM 656 O OG . SER A 1 83 ? 8.686 24.518 28.132 1.00 11.50 ? 83 SER A OG 1 5: ATOM 657 N N . LEU A 1 84 ? 6.028 22.620 30.954 1.00 11.17 ? 84 LEU A N 1 5: ATOM 658 C CA . LEU A 1 84 ? 5.557 22.016 32.192 1.00 11.84 ? 84 LEU A CA 1 5: ATOM 659 C C . LEU A 1 84 ? 6.427 20.793 32.470 1.00 10.42 ? 84 LEU A C 1 5: ATOM 660 O O . LEU A 1 84 ? 6.444 19.846 31.684 1.00 11.20 ? 84 LEU A O 1 5: ATOM 661 C CB . LEU A 1 84 ? 4.091 21.576 32.067 1.00 13.44 ? 84 LEU A CB 1 5: ATOM 662 C CG . LEU A 1 84 ? 3.552 20.784 33.270 1.00 15.74 ? 84 LEU A CG 1 5: ATOM 663 C CD1 . LEU A 1 84 ? 3.515 21.683 34.484 1.00 16.96 ? 84 LEU A CD1 1 5: ATOM 664 C CD2 . LEU A 1 84 ? 2.178 20.231 32.982 1.00 18.76 ? 84 LEU A CD2 1 5: ATOM 665 N N . VAL A 1 85 ? 7.146 20.828 33.589 1.00 9.60 ? 85 VAL A N 1 5: ATOM 666 C CA . VAL A 1 85 ? 8.028 19.738 34.006 1.00 9.50 ? 85 VAL A CA 1 5: ATOM 667 C C . VAL A 1 85 ? 7.344 18.878 35.082 1.00 9.74 ? 85 VAL A C 1 5: ATOM 668 O O . VAL A 1 85 ? 6.680 19.404 35.985 1.00 9.28 ? 85 VAL A O 1 5: ATOM 669 C CB . VAL A 1 85 ? 9.384 20.291 34.598 1.00 8.89 ? 85 VAL A CB 1 5: ATOM 670 C CG1 . VAL A 1 85 ? 10.327 19.140 34.970 1.00 8.20 ? 85 VAL A CG1 1 5: ATOM 671 C CG2 . VAL A 1 85 ? 10.062 21.227 33.612 1.00 8.48 ? 85 VAL A CG2 1 5: ATOM 672 N N . LYS A 1 86 ? 7.504 17.563 34.971 1.00 9.96 ? 86 LYS A N 1 5: ATOM 673 C CA . LYS A 1 86 ? 6.946 16.621 35.945 1.00 11.92 ? 86 LYS A CA 1 5: ATOM 674 C C . LYS A 1 86 ? 8.003 15.558 36.247 1.00 11.88 ? 86 LYS A C 1 5: ATOM 675 O O . LYS A 1 86 ? 8.917 15.340 35.453 1.00 11.00 ? 86 LYS A O 1 5: ATOM 676 C CB . LYS A 1 86 ? 5.700 15.911 35.385 1.00 12.40 ? 86 LYS A CB 1 5: ATOM 677 C CG . LYS A 1 86 ? 4.538 16.819 35.058 1.00 16.01 ? 86 LYS A CG 1 5: ATOM 678 C CD . LYS A 1 86 ? 3.333 16.017 34.559 1.00 21.36 ? 86 LYS A CD 1 5: ATOM 679 C CE . LYS A 1 86 ? 2.140 16.939 34.345 1.00 23.23 ? 86 LYS A CE 1 5: ATOM 680 N NZ . LYS A 1 86 ? 0.919 16.212 33.929 1.00 28.41 ? 86 LYS A NZ 1 5: ATOM 681 N N . TRP A 1 87 ? 7.868 14.889 37.386 1.00 10.75 ? 87 TRP A N 1 5: ATOM 682 C CA . TRP A 1 87 ? 8.775 13.811 37.738 1.00 9.53 ? 87 TRP A CA 1 5: ATOM 683 C C . TRP A 1 87 ? 8.238 12.559 37.052 1.00 9.89 ? 87 TRP A C 1 5: ATOM 684 O O . TRP A 1 87 ? 7.144 12.107 37.370 1.00 11.80 ? 87 TRP A O 1 5: ATOM 685 C CB . TRP A 1 87 ? 8.791 13.569 39.268 1.00 8.76 ? 87 TRP A CB 1 5: ATOM 686 C CG . TRP A 1 87 ? 9.494 14.641 40.062 1.00 8.86 ? 87 TRP A CG 1 5: ATOM 687 C CD1 . TRP A 1 87 ? 8.923 15.525 40.939 1.00 8.80 ? 87 TRP A CD1 1 5: ATOM 688 C CD2 . TRP A 1 87 ? 10.889 14.990 39.992 1.00 9.42 ? 87 TRP A CD2 1 5: ATOM 689 N NE1 . TRP A 1 87 ? 9.872 16.410 41.400 1.00 8.01 ? 87 TRP A NE1 1 5: ATOM 690 C CE2 . TRP A 1 87 ? 11.086 16.103 40.835 1.00 10.85 ? 87 TRP A CE2 1 5: ATOM 691 C CE3 . TRP A 1 87 ? 11.985 14.475 39.283 1.00 9.60 ? 87 TRP A CE3 1 5: ATOM 692 C CZ2 . TRP A 1 87 ? 12.340 16.716 40.994 1.00 11.45 ? 87 TRP A CZ2 1 5: ATOM 693 C CZ3 . TRP A 1 87 ? 13.230 15.084 39.438 1.00 10.72 ? 87 TRP A CZ3 1 5: ATOM 694 C CH2 . TRP A 1 87 ? 13.395 16.192 40.289 1.00 11.78 ? 87 TRP A CH2 1 5: ATOM 695 N N . GLU A 1 88 ? 8.954 12.040 36.064 1.00 9.93 ? 88 GLU A N 1 5: ATOM 696 C CA . GLU A 1 88 ? 8.526 10.807 35.416 1.00 11.30 ? 88 GLU A CA 1 5: ATOM 697 C C . GLU A 1 88 ? 8.826 9.726 36.448 1.00 11.75 ? 88 GLU A C 1 5: ATOM 698 O O . GLU A 1 88 ? 8.068 8.784 36.623 1.00 12.78 ? 88 GLU A O 1 5: ATOM 699 C CB . GLU A 1 88 ? 9.337 10.541 34.156 1.00 13.50 ? 88 GLU A CB 1 5: ATOM 700 C CG . GLU A 1 88 ? 8.917 9.261 33.454 1.00 18.67 ? 88 GLU A CG 1 5: ATOM 701 C CD . GLU A 1 88 ? 9.756 8.958 32.226 1.00 23.49 ? 88 GLU A CD 1 5: ATOM 702 O OE1 . GLU A 1 88 ? 9.581 9.650 31.205 1.00 26.53 ? 88 GLU A OE1 1 5: ATOM 703 O OE2 . GLU A 1 88 ? 10.587 8.025 32.276 1.00 26.54 ? 88 GLU A OE2 1 5: ATOM 704 N N . SER A 1 89 ? 9.972 9.870 37.103 1.00 11.49 ? 89 SER A N 1 5: ATOM 705 C CA . SER A 1 89 ? 10.402 8.954 38.158 1.00 11.10 ? 89 SER A CA 1 5: ATOM 706 C C . SER A 1 89 ? 11.206 9.776 39.163 1.00 11.14 ? 89 SER A C 1 5: ATOM 707 O O . SER A 1 89 ? 11.397 10.983 38.979 1.00 9.92 ? 89 SER A O 1 5: ATOM 708 C CB . SER A 1 89 ? 11.221 7.778 37.604 1.00 12.43 ? 89 SER A CB 1 5: ATOM 709 O OG . SER A 1 89 ? 12.396 8.215 36.947 1.00 14.39 ? 89 SER A OG 1 5: ATOM 710 N N . GLU A 1 90 ? 11.674 9.130 40.227 1.00 10.17 ? 90 GLU A N 1 5: ATOM 711 C CA . GLU A 1 90 ? 12.433 9.826 41.254 1.00 10.83 ? 90 GLU A CA 1 5: ATOM 712 C C . GLU A 1 90 ? 13.657 10.629 40.772 1.00 9.86 ? 90 GLU A C 1 5: ATOM 713 O O . GLU A 1 90 ? 13.932 11.715 41.289 1.00 10.30 ? 90 GLU A O 1 5: ATOM 714 C CB . GLU A 1 90 ? 12.858 8.846 42.348 1.00 11.92 ? 90 GLU A CB 1 5: ATOM 715 C CG . GLU A 1 90 ? 13.536 9.572 43.487 1.00 16.53 ? 90 GLU A CG 1 5: ATOM 716 C CD . GLU A 1 90 ? 13.912 8.671 44.644 1.00 19.80 ? 90 GLU A CD 1 5: ATOM 717 O OE1 . GLU A 1 90 ? 14.122 7.464 44.426 1.00 21.18 ? 90 GLU A OE1 1 5: ATOM 718 O OE2 . GLU A 1 90 ? 14.012 9.187 45.774 1.00 22.91 ? 90 GLU A OE2 1 5: ATOM 719 N N . ASN A 1 91 ? 14.376 10.102 39.783 1.00 8.79 ? 91 ASN A N 1 5: ATOM 720 C CA . ASN A 1 91 ? 15.578 10.767 39.274 1.00 10.50 ? 91 ASN A CA 1 5: ATOM 721 C C . ASN A 1 91 ? 15.455 11.289 37.855 1.00 9.69 ? 91 ASN A C 1 5: ATOM 722 O O . ASN A 1 91 ? 16.467 11.627 37.246 1.00 7.10 ? 91 ASN A O 1 5: ATOM 723 C CB . ASN A 1 91 ? 16.760 9.798 39.305 1.00 14.33 ? 91 ASN A CB 1 5: ATOM 724 C CG . ASN A 1 91 ? 17.064 9.307 40.693 1.00 17.71 ? 91 ASN A CG 1 5: ATOM 725 O OD1 . ASN A 1 91 ? 17.445 10.087 41.560 1.00 20.87 ? 91 ASN A OD1 1 5: ATOM 726 N ND2 . ASN A 1 91 ? 16.855 8.016 40.928 1.00 19.39 ? 91 ASN A ND2 1 5: ATOM 727 N N . LYS A 1 92 ? 14.230 11.387 37.352 1.00 8.60 ? 92 LYS A N 1 5: ATOM 728 C CA . LYS A 1 92 ? 14.016 11.835 35.981 1.00 8.88 ? 92 LYS A CA 1 5: ATOM 729 C C . LYS A 1 92 ? 12.861 12.812 35.807 1.00 8.61 ? 92 LYS A C 1 5: ATOM 730 O O . LYS A 1 92 ? 11.721 12.511 36.168 1.00 8.95 ? 92 LYS A O 1 5: ATOM 731 C CB . LYS A 1 92 ? 13.781 10.626 35.078 1.00 9.10 ? 92 LYS A CB 1 5: ATOM 732 C CG . LYS A 1 92 ? 13.566 10.996 33.618 1.00 11.95 ? 92 LYS A CG 1 5: ATOM 733 C CD . LYS A 1 92 ? 13.467 9.762 32.759 1.00 14.04 ? 92 LYS A CD 1 5: ATOM 734 C CE . LYS A 1 92 ? 13.333 10.124 31.299 1.00 16.33 ? 92 LYS A CE 1 5: ATOM 735 N NZ . LYS A 1 92 ? 13.129 8.884 30.506 1.00 17.37 ? 92 LYS A NZ 1 5: ATOM 736 N N . MET A 1 93 ? 13.172 13.988 35.268 1.00 7.58 ? 93 MET A N 1 5: ATOM 737 C CA . MET A 1 93 ? 12.159 14.985 34.995 1.00 8.21 ? 93 MET A CA 1 5: ATOM 738 C C . MET A 1 93 ? 11.915 15.038 33.496 1.00 9.18 ? 93 MET A C 1 5: ATOM 739 O O . MET A 1 93 ? 12.833 14.838 32.690 1.00 7.74 ? 93 MET A O 1 5: ATOM 740 C CB . MET A 1 93 ? 12.565 16.359 35.523 1.00 9.68 ? 93 MET A CB 1 5: ATOM 741 C CG . MET A 1 93 ? 13.826 16.925 34.937 1.00 13.16 ? 93 MET A CG 1 5: ATOM 742 S SD . MET A 1 93 ? 14.238 18.543 35.628 1.00 17.49 ? 93 MET A SD 1 5: ATOM 743 C CE . MET A 1 93 ? 15.009 18.106 37.076 1.00 18.53 ? 93 MET A CE 1 5: ATOM 744 N N . VAL A 1 94 ? 10.658 15.239 33.128 1.00 9.48 ? 94 VAL A N 1 5: ATOM 745 C CA . VAL A 1 94 ? 10.266 15.334 31.726 1.00 9.55 ? 94 VAL A CA 1 5: ATOM 746 C C . VAL A 1 94 ? 9.516 16.639 31.528 1.00 10.10 ? 94 VAL A C 1 5: ATOM 747 O O . VAL A 1 94 ? 8.683 17.024 32.364 1.00 9.47 ? 94 VAL A O 1 5: ATOM 748 C CB . VAL A 1 94 ? 9.371 14.164 31.315 1.00 11.05 ? 94 VAL A CB 1 5: ATOM 749 C CG1 . VAL A 1 94 ? 8.878 14.354 29.878 1.00 12.88 ? 94 VAL A CG1 1 5: ATOM 750 C CG2 . VAL A 1 94 ? 10.147 12.866 31.420 1.00 14.00 ? 94 VAL A CG2 1 5: ATOM 751 N N . CYS A 1 95 ? 9.802 17.312 30.413 1.00 9.49 ? 95 CYS A N 1 5: ATOM 752 C CA . CYS A 1 95 ? 9.169 18.582 30.094 1.00 8.82 ? 95 CYS A CA 1 5: ATOM 753 C C . CYS A 1 95 ? 8.431 18.559 28.758 1.00 11.70 ? 95 CYS A C 1 5: ATOM 754 O O . CYS A 1 95 ? 9.014 18.215 27.723 1.00 12.29 ? 95 CYS A O 1 5: ATOM 755 C CB . CYS A 1 95 ? 10.229 19.679 30.059 1.00 8.79 ? 95 CYS A CB 1 5: ATOM 756 S SG . CYS A 1 95 ? 9.620 21.322 29.690 1.00 10.97 ? 95 CYS A SG 1 5: ATOM 757 N N . GLU A 1 96 ? 7.149 18.902 28.791 1.00 10.87 ? 96 GLU A N 1 5: ATOM 758 C CA . GLU A 1 96 ? 6.342 18.962 27.587 1.00 14.78 ? 96 GLU A CA 1 5: ATOM 759 C C . GLU A 1 96 ? 6.267 20.439 27.182 1.00 13.83 ? 96 GLU A C 1 5: ATOM 760 O O . GLU A 1 96 ? 6.044 21.311 28.030 1.00 12.79 ? 96 GLU A O 1 5: ATOM 761 C CB . GLU A 1 96 ? 4.957 18.397 27.885 1.00 20.21 ? 96 GLU A CB 1 5: ATOM 762 C CG . GLU A 1 96 ? 3.981 18.432 26.726 1.00 32.46 ? 96 GLU A CG 1 5: ATOM 763 C CD . GLU A 1 96 ? 2.646 17.765 27.065 1.00 38.97 ? 96 GLU A CD 1 5: ATOM 764 O OE1 . GLU A 1 96 ? 2.053 18.108 28.128 1.00 42.61 ? 96 GLU A OE1 1 5: ATOM 765 O OE2 . GLU A 1 96 ? 2.201 16.892 26.271 1.00 42.17 ? 96 GLU A OE2 1 5: ATOM 766 N N . GLN A 1 97 ? 6.513 20.725 25.903 1.00 13.39 ? 97 GLN A N 1 5: ATOM 767 C CA . GLN A 1 97 ? 6.489 22.100 25.402 1.00 13.55 ? 97 GLN A CA 1 5: ATOM 768 C C . GLN A 1 97 ? 5.357 22.334 24.400 1.00 15.88 ? 97 GLN A C 1 5: ATOM 769 O O . GLN A 1 97 ? 5.013 21.455 23.591 1.00 16.25 ? 97 GLN A O 1 5: ATOM 770 C CB . GLN A 1 97 ? 7.823 22.465 24.747 1.00 12.20 ? 97 GLN A CB 1 5: ATOM 771 C CG . GLN A 1 97 ? 9.033 22.324 25.650 1.00 12.55 ? 97 GLN A CG 1 5: ATOM 772 C CD . GLN A 1 97 ? 10.321 22.613 24.927 1.00 14.20 ? 97 GLN A CD 1 5: ATOM 773 O OE1 . GLN A 1 97 ? 10.478 22.288 23.749 1.00 12.94 ? 97 GLN A OE1 1 5: ATOM 774 N NE2 . GLN A 1 97 ? 11.260 23.235 25.627 1.00 14.75 ? 97 GLN A NE2 1 5: ATOM 775 N N . LYS A 1 98 ? 4.801 23.541 24.450 1.00 17.30 ? 98 LYS A N 1 5: ATOM 776 C CA . LYS A 1 98 ? 3.696 23.952 23.582 1.00 19.78 ? 98 LYS A CA 1 5: ATOM 777 C C . LYS A 1 98 ? 3.990 25.340 23.019 1.00 18.56 ? 98 LYS A C 1 5: ATOM 778 O O . LYS A 1 98 ? 4.162 26.293 23.771 1.00 17.70 ? 98 LYS A O 1 5: ATOM 779 C CB . LYS A 1 98 ? 2.389 23.953 24.389 1.00 23.30 ? 98 LYS A CB 1 5: ATOM 780 C CG . LYS A 1 98 ? 1.294 24.857 23.867 1.00 30.94 ? 98 LYS A CG 1 5: ATOM 781 C CD . LYS A 1 98 ? 0.210 25.047 24.934 1.00 37.10 ? 98 LYS A CD 1 5: ATOM 782 C CE . LYS A 1 98 ? -0.849 26.072 24.520 1.00 39.73 ? 98 LYS A CE 1 5: ATOM 783 N NZ . LYS A 1 98 ? -0.326 27.476 24.541 1.00 42.46 ? 98 LYS A NZ 1 5: ATOM 784 N N . LEU A 1 99 ? 4.073 25.445 21.696 1.00 19.35 ? 99 LEU A N 1 5: ATOM 785 C CA . LEU A 1 99 ? 4.357 26.721 21.041 1.00 21.32 ? 99 LEU A CA 1 5: ATOM 786 C C . LEU A 1 99 ? 3.307 27.770 21.351 1.00 22.86 ? 99 LEU A C 1 5: ATOM 787 O O . LEU A 1 99 ? 2.108 27.496 21.261 1.00 23.41 ? 99 LEU A O 1 5: ATOM 788 C CB . LEU A 1 99 ? 4.466 26.542 19.526 1.00 22.09 ? 99 LEU A CB 1 5: ATOM 789 C CG . LEU A 1 99 ? 5.692 25.792 18.997 1.00 22.72 ? 99 LEU A CG 1 5: ATOM 790 C CD1 . LEU A 1 99 ? 5.585 25.639 17.490 1.00 23.04 ? 99 LEU A CD1 1 5: ATOM 791 C CD2 . LEU A 1 99 ? 6.951 26.548 19.372 1.00 23.61 ? 99 LEU A CD2 1 5: ATOM 792 N N . LEU A 1 100 ? 3.767 28.962 21.722 1.00 24.11 ? 100 LEU A N 1 5: ATOM 793 C CA . LEU A 1 100 ? 2.879 30.070 22.051 1.00 27.59 ? 100 LEU A CA 1 5: ATOM 794 C C . LEU A 1 100 ? 2.130 30.545 20.815 1.00 30.94 ? 100 LEU A C 1 5: ATOM 795 O O . LEU A 1 100 ? 0.951 30.908 20.877 1.00 31.34 ? 100 LEU A O 1 5: ATOM 796 C CB . LEU A 1 100 ? 3.680 31.227 22.640 1.00 25.50 ? 100 LEU A CB 1 5: ATOM 797 C CG . LEU A 1 100 ? 4.254 30.947 24.020 1.00 24.80 ? 100 LEU A CG 1 5: ATOM 798 C CD1 . LEU A 1 100 ? 4.960 32.171 24.542 1.00 26.59 ? 100 LEU A CD1 1 5: ATOM 799 C CD2 . LEU A 1 100 ? 3.141 30.554 24.935 1.00 24.80 ? 100 LEU A CD2 1 5: ATOM 800 N N . LYS A 1 101 ? 2.835 30.531 19.689 1.00 34.60 ? 101 LYS A N 1 5: ATOM 801 C CA . LYS A 1 101 ? 2.282 30.961 18.413 1.00 37.81 ? 101 LYS A CA 1 5: ATOM 802 C C . LYS A 1 101 ? 2.847 30.088 17.292 1.00 37.39 ? 101 LYS A C 1 5: ATOM 803 O O . LYS A 1 101 ? 4.019 29.687 17.319 1.00 37.22 ? 101 LYS A O 1 5: ATOM 804 C CB . LYS A 1 101 ? 2.653 32.429 18.147 1.00 40.57 ? 101 LYS A CB 1 5: ATOM 805 C CG . LYS A 1 101 ? 2.182 33.426 19.212 1.00 45.13 ? 101 LYS A CG 1 5: ATOM 806 C CD . LYS A 1 101 ? 2.955 34.741 19.125 1.00 48.57 ? 101 LYS A CD 1 5: ATOM 807 C CE . LYS A 1 101 ? 4.479 34.527 19.248 1.00 51.31 ? 101 LYS A CE 1 5: ATOM 808 N NZ . LYS A 1 101 ? 4.917 33.952 20.559 1.00 51.14 ? 101 LYS A NZ 1 5: ATOM 809 N N . GLY A 1 102 ? 1.997 29.786 16.318 1.00 37.21 ? 102 GLY A N 1 5: ATOM 810 C CA . GLY A 1 102 ? 2.423 28.993 15.184 1.00 36.82 ? 102 GLY A CA 1 5: ATOM 811 C C . GLY A 1 102 ? 2.333 27.494 15.344 1.00 36.36 ? 102 GLY A C 1 5: ATOM 812 O O . GLY A 1 102 ? 1.690 26.977 16.265 1.00 35.74 ? 102 GLY A O 1 5: ATOM 813 N N . GLU A 1 103 ? 2.954 26.803 14.395 1.00 35.74 ? 103 GLU A N 1 5: ATOM 814 C CA . GLU A 1 103 ? 2.988 25.348 14.377 1.00 35.50 ? 103 GLU A CA 1 5: ATOM 815 C C . GLU A 1 103 ? 4.418 24.880 14.140 1.00 31.92 ? 103 GLU A C 1 5: ATOM 816 O O . GLU A 1 103 ? 5.281 25.654 13.723 1.00 31.61 ? 103 GLU A O 1 5: ATOM 817 C CB . GLU A 1 103 ? 2.077 24.784 13.274 1.00 39.37 ? 103 GLU A CB 1 5: ATOM 818 C CG . GLU A 1 103 ? 0.652 24.422 13.712 1.00 45.52 ? 103 GLU A CG 1 5: ATOM 819 C CD . GLU A 1 103 ? -0.383 25.503 13.395 1.00 50.23 ? 103 GLU A CD 1 5: ATOM 820 O OE1 . GLU A 1 103 ? -0.130 26.346 12.499 1.00 53.12 ? 103 GLU A OE1 1 5: ATOM 821 O OE2 . GLU A 1 103 ? -1.464 25.500 14.036 1.00 52.16 ? 103 GLU A OE2 1 5: ATOM 822 N N . GLY A 1 104 ? 4.653 23.604 14.414 1.00 28.97 ? 104 GLY A N 1 5: ATOM 823 C CA . GLY A 1 104 ? 5.967 23.024 14.231 1.00 25.41 ? 104 GLY A CA 1 5: ATOM 824 C C . GLY A 1 104 ? 6.012 21.648 14.863 1.00 22.09 ? 104 GLY A C 1 5: ATOM 825 O O . GLY A 1 104 ? 4.987 21.160 15.347 1.00 21.89 ? 104 GLY A O 1 5: ATOM 826 N N . PRO A 1 105 ? 7.176 20.976 14.832 1.00 19.50 ? 105 PRO A N 1 5: ATOM 827 C CA . PRO A 1 105 ? 7.338 19.640 15.418 1.00 17.92 ? 105 PRO A CA 1 5: ATOM 828 C C . PRO A 1 105 ? 7.020 19.664 16.914 1.00 15.61 ? 105 PRO A C 1 5: ATOM 829 O O . PRO A 1 105 ? 7.170 20.696 17.567 1.00 14.42 ? 105 PRO A O 1 5: ATOM 830 C CB . PRO A 1 105 ? 8.828 19.348 15.202 1.00 18.86 ? 105 PRO A CB 1 5: ATOM 831 C CG . PRO A 1 105 ? 9.188 20.164 14.005 1.00 18.76 ? 105 PRO A CG 1 5: ATOM 832 C CD . PRO A 1 105 ? 8.423 21.440 14.199 1.00 18.40 ? 105 PRO A CD 1 5: ATOM 833 N N . LYS A 1 106 ? 6.552 18.541 17.444 1.00 16.02 ? 106 LYS A N 1 5: ATOM 834 C CA . LYS A 1 106 ? 6.255 18.453 18.868 1.00 16.93 ? 106 LYS A CA 1 5: ATOM 835 C C . LYS A 1 106 ? 7.609 18.305 19.554 1.00 15.49 ? 106 LYS A C 1 5: ATOM 836 O O . LYS A 1 106 ? 8.397 17.437 19.183 1.00 14.76 ? 106 LYS A O 1 5: ATOM 837 C CB . LYS A 1 106 ? 5.387 17.229 19.174 1.00 20.98 ? 106 LYS A CB 1 5: ATOM 838 C CG . LYS A 1 106 ? 5.015 17.097 20.662 1.00 27.98 ? 106 LYS A CG 1 5: ATOM 839 C CD . LYS A 1 106 ? 4.463 18.433 21.229 1.00 33.23 ? 106 LYS A CD 1 5: ATOM 840 C CE . LYS A 1 106 ? 4.250 18.417 22.764 1.00 35.21 ? 106 LYS A CE 1 5: ATOM 841 N NZ . LYS A 1 106 ? 5.519 18.251 23.566 1.00 33.75 ? 106 LYS A NZ 1 5: ATOM 842 N N . THR A 1 107 ? 7.907 19.167 20.515 1.00 13.91 ? 107 THR A N 1 5: ATOM 843 C CA . THR A 1 107 ? 9.203 19.086 21.190 1.00 12.14 ? 107 THR A CA 1 5: ATOM 844 C C . THR A 1 107 ? 9.083 18.819 22.681 1.00 11.66 ? 107 THR A C 1 5: ATOM 845 O O . THR A 1 107 ? 8.061 19.120 23.295 1.00 10.59 ? 107 THR A O 1 5: ATOM 846 C CB . THR A 1 107 ? 10.012 20.382 21.016 1.00 12.37 ? 107 THR A CB 1 5: ATOM 847 O OG1 . THR A 1 107 ? 9.263 21.480 21.547 1.00 12.36 ? 107 THR A OG1 1 5: ATOM 848 C CG2 . THR A 1 107 ? 10.327 20.643 19.544 1.00 12.62 ? 107 THR A CG2 1 5: ATOM 849 N N . SER A 1 108 ? 10.140 18.249 23.250 1.00 10.16 ? 108 SER A N 1 5: ATOM 850 C CA . SER A 1 108 ? 10.192 17.975 24.681 1.00 9.98 ? 108 SER A CA 1 5: ATOM 851 C C . SER A 1 108 ? 11.649 17.774 25.081 1.00 9.90 ? 108 SER A C 1 5: ATOM 852 O O . SER A 1 108 ? 12.549 17.774 24.227 1.00 8.48 ? 108 SER A O 1 5: ATOM 853 C CB . SER A 1 108 ? 9.370 16.729 25.024 1.00 9.84 ? 108 SER A CB 1 5: ATOM 854 O OG . SER A 1 108 ? 9.844 15.601 24.313 1.00 13.87 ? 108 SER A OG 1 5: ATOM 855 N N . TRP A 1 109 ? 11.890 17.708 26.386 1.00 7.96 ? 109 TRP A N 1 5: ATOM 856 C CA . TRP A 1 109 ? 13.233 17.446 26.894 1.00 7.85 ? 109 TRP A CA 1 5: ATOM 857 C C . TRP A 1 109 ? 13.109 16.693 28.209 1.00 7.56 ? 109 TRP A C 1 5: ATOM 858 O O . TRP A 1 109 ? 12.053 16.728 28.837 1.00 8.14 ? 109 TRP A O 1 5: ATOM 859 C CB . TRP A 1 109 ? 14.094 18.722 27.051 1.00 8.25 ? 109 TRP A CB 1 5: ATOM 860 C CG . TRP A 1 109 ? 13.627 19.829 28.007 1.00 8.07 ? 109 TRP A CG 1 5: ATOM 861 C CD1 . TRP A 1 109 ? 13.120 21.046 27.648 1.00 9.28 ? 109 TRP A CD1 1 5: ATOM 862 C CD2 . TRP A 1 109 ? 13.745 19.865 29.450 1.00 9.31 ? 109 TRP A CD2 1 5: ATOM 863 N NE1 . TRP A 1 109 ? 12.929 21.836 28.760 1.00 9.69 ? 109 TRP A NE1 1 5: ATOM 864 C CE2 . TRP A 1 109 ? 13.306 21.136 29.878 1.00 9.04 ? 109 TRP A CE2 1 5: ATOM 865 C CE3 . TRP A 1 109 ? 14.186 18.939 30.416 1.00 9.92 ? 109 TRP A CE3 1 5: ATOM 866 C CZ2 . TRP A 1 109 ? 13.286 21.515 31.228 1.00 9.72 ? 109 TRP A CZ2 1 5: ATOM 867 C CZ3 . TRP A 1 109 ? 14.163 19.316 31.758 1.00 10.25 ? 109 TRP A CZ3 1 5: ATOM 868 C CH2 . TRP A 1 109 ? 13.717 20.593 32.149 1.00 10.11 ? 109 TRP A CH2 1 5: ATOM 869 N N . THR A 1 110 ? 14.136 15.924 28.549 1.00 7.39 ? 110 THR A N 1 5: ATOM 870 C CA . THR A 1 110 ? 14.168 15.176 29.808 1.00 6.23 ? 110 THR A CA 1 5: ATOM 871 C C . THR A 1 110 ? 15.577 15.334 30.395 1.00 7.40 ? 110 THR A C 1 5: ATOM 872 O O . THR A 1 110 ? 16.558 15.563 29.652 1.00 6.43 ? 110 THR A O 1 5: ATOM 873 C CB . THR A 1 110 ? 13.887 13.633 29.626 1.00 7.17 ? 110 THR A CB 1 5: ATOM 874 O OG1 . THR A 1 110 ? 15.000 13.002 28.973 1.00 7.49 ? 110 THR A OG1 1 5: ATOM 875 C CG2 . THR A 1 110 ? 12.616 13.377 28.803 1.00 6.64 ? 110 THR A CG2 1 5: ATOM 876 N N . ARG A 1 111 ? 15.669 15.293 31.727 1.00 6.72 ? 111 ARG A N 1 5: ATOM 877 C CA . ARG A 1 111 ? 16.966 15.356 32.425 1.00 6.27 ? 111 ARG A CA 1 5: ATOM 878 C C . ARG A 1 111 ? 16.924 14.287 33.483 1.00 7.89 ? 111 ARG A C 1 5: ATOM 879 O O . ARG A 1 111 ? 15.928 14.156 34.193 1.00 8.35 ? 111 ARG A O 1 5: ATOM 880 C CB . ARG A 1 111 ? 17.240 16.722 33.068 1.00 6.20 ? 111 ARG A CB 1 5: ATOM 881 C CG . ARG A 1 111 ? 17.703 17.765 32.060 1.00 7.38 ? 111 ARG A CG 1 5: ATOM 882 C CD . ARG A 1 111 ? 18.100 19.072 32.727 1.00 8.70 ? 111 ARG A CD 1 5: ATOM 883 N NE . ARG A 1 111 ? 18.783 19.965 31.784 1.00 9.83 ? 111 ARG A NE 1 5: ATOM 884 C CZ . ARG A 1 111 ? 18.158 20.804 30.963 1.00 10.23 ? 111 ARG A CZ 1 5: ATOM 885 N NH1 . ARG A 1 111 ? 16.840 20.869 30.966 1.00 10.89 ? 111 ARG A NH1 1 5: ATOM 886 N NH2 . ARG A 1 111 ? 18.847 21.590 30.144 1.00 11.56 ? 111 ARG A NH2 1 5: ATOM 887 N N . GLU A 1 112 ? 17.957 13.464 33.534 1.00 7.64 ? 112 GLU A N 1 5: ATOM 888 C CA . GLU A 1 112 ? 17.977 12.402 34.527 1.00 10.31 ? 112 GLU A CA 1 5: ATOM 889 C C . GLU A 1 112 ? 19.356 12.142 35.113 1.00 9.93 ? 112 GLU A C 1 5: ATOM 890 O O . GLU A 1 112 ? 20.367 12.273 34.425 1.00 7.92 ? 112 GLU A O 1 5: ATOM 891 C CB . GLU A 1 112 ? 17.401 11.118 33.940 1.00 14.05 ? 112 GLU A CB 1 5: ATOM 892 C CG . GLU A 1 112 ? 18.213 10.489 32.836 1.00 20.37 ? 112 GLU A CG 1 5: ATOM 893 C CD . GLU A 1 112 ? 17.484 9.325 32.177 1.00 25.09 ? 112 GLU A CD 1 5: ATOM 894 O OE1 . GLU A 1 112 ? 17.223 8.308 32.883 1.00 22.36 ? 112 GLU A OE1 1 5: ATOM 895 O OE2 . GLU A 1 112 ? 17.175 9.443 30.955 1.00 25.10 ? 112 GLU A OE2 1 5: ATOM 896 N N . LEU A 1 113 ? 19.387 11.816 36.401 1.00 8.96 ? 113 LEU A N 1 5: ATOM 897 C CA . LEU A 1 113 ? 20.634 11.503 37.091 1.00 12.04 ? 113 LEU A CA 1 5: ATOM 898 C C . LEU A 1 113 ? 20.789 9.991 37.081 1.00 12.06 ? 113 LEU A C 1 5: ATOM 899 O O . LEU A 1 113 ? 19.906 9.270 37.559 1.00 12.08 ? 113 LEU A O 1 5: ATOM 900 C CB . LEU A 1 113 ? 20.575 11.983 38.532 1.00 14.38 ? 113 LEU A CB 1 5: ATOM 901 C CG . LEU A 1 113 ? 20.768 13.465 38.799 1.00 17.46 ? 113 LEU A CG 1 5: ATOM 902 C CD1 . LEU A 1 113 ? 20.709 13.656 40.298 1.00 19.61 ? 113 LEU A CD1 1 5: ATOM 903 C CD2 . LEU A 1 113 ? 22.128 13.945 38.266 1.00 18.46 ? 113 LEU A CD2 1 5: ATOM 904 N N . THR A 1 114 ? 21.895 9.502 36.535 1.00 11.06 ? 114 THR A N 1 5: ATOM 905 C CA . THR A 1 114 ? 22.110 8.062 36.452 1.00 11.74 ? 114 THR A CA 1 5: ATOM 906 C C . THR A 1 114 ? 22.816 7.522 37.686 1.00 11.41 ? 114 THR A C 1 5: ATOM 907 O O . THR A 1 114 ? 23.327 8.282 38.501 1.00 11.47 ? 114 THR A O 1 5: ATOM 908 C CB . THR A 1 114 ? 22.894 7.700 35.188 1.00 12.89 ? 114 THR A CB 1 5: ATOM 909 O OG1 . THR A 1 114 ? 24.109 8.451 35.164 1.00 15.50 ? 114 THR A OG1 1 5: ATOM 910 C CG2 . THR A 1 114 ? 22.075 8.037 33.951 1.00 14.75 ? 114 THR A CG2 1 5: ATOM 911 N N . ASN A 1 115 ? 22.834 6.202 37.808 1.00 13.23 ? 115 ASN A N 1 5: ATOM 912 C CA . ASN A 1 115 ? 23.441 5.538 38.951 1.00 16.19 ? 115 ASN A CA 1 5: ATOM 913 C C . ASN A 1 115 ? 24.930 5.761 39.139 1.00 14.24 ? 115 ASN A C 1 5: ATOM 914 O O . ASN A 1 115 ? 25.432 5.626 40.256 1.00 14.74 ? 115 ASN A O 1 5: ATOM 915 C CB . ASN A 1 115 ? 23.123 4.047 38.918 1.00 21.89 ? 115 ASN A CB 1 5: ATOM 916 C CG . ASN A 1 115 ? 21.703 3.754 39.357 1.00 29.77 ? 115 ASN A CG 1 5: ATOM 917 O OD1 . ASN A 1 115 ? 20.955 3.046 38.669 1.00 34.83 ? 115 ASN A OD1 1 5: ATOM 918 N ND2 . ASN A 1 115 ? 21.313 4.310 40.516 1.00 32.90 ? 115 ASN A ND2 1 5: ATOM 919 N N . ASP A 1 116 ? 25.626 6.095 38.055 1.00 12.05 ? 116 ASP A N 1 5: ATOM 920 C CA . ASP A 1 116 ? 27.061 6.364 38.094 1.00 11.99 ? 116 ASP A CA 1 5: ATOM 921 C C . ASP A 1 116 ? 27.424 7.821 38.397 1.00 11.45 ? 116 ASP A C 1 5: ATOM 922 O O . ASP A 1 116 ? 28.592 8.184 38.393 1.00 12.23 ? 116 ASP A O 1 5: ATOM 923 C CB . ASP A 1 116 ? 27.764 5.875 36.806 1.00 13.89 ? 116 ASP A CB 1 5: ATOM 924 C CG . ASP A 1 116 ? 27.177 6.474 35.512 1.00 16.58 ? 116 ASP A CG 1 5: ATOM 925 O OD1 . ASP A 1 116 ? 26.263 7.303 35.569 1.00 19.66 ? 116 ASP A OD1 1 5: ATOM 926 O OD2 . ASP A 1 116 ? 27.651 6.113 34.422 1.00 20.14 ? 116 ASP A OD2 1 5: ATOM 927 N N . GLY A 1 117 ? 26.420 8.647 38.675 1.00 10.58 ? 117 GLY A N 1 5: ATOM 928 C CA . GLY A 1 117 ? 26.669 10.042 38.997 1.00 9.83 ? 117 GLY A CA 1 5: ATOM 929 C C . GLY A 1 117 ? 26.652 11.019 37.831 1.00 9.97 ? 117 GLY A C 1 5: ATOM 930 O O . GLY A 1 117 ? 26.945 12.192 38.019 1.00 10.45 ? 117 GLY A O 1 5: ATOM 931 N N . GLU A 1 118 ? 26.289 10.550 36.638 1.00 9.43 ? 118 GLU A N 1 5: ATOM 932 C CA . GLU A 1 118 ? 26.242 11.413 35.458 1.00 7.79 ? 118 GLU A CA 1 5: ATOM 933 C C . GLU A 1 118 ? 24.834 11.955 35.213 1.00 7.60 ? 118 GLU A C 1 5: ATOM 934 O O . GLU A 1 118 ? 23.872 11.565 35.885 1.00 8.05 ? 118 GLU A O 1 5: ATOM 935 C CB . GLU A 1 118 ? 26.776 10.653 34.241 1.00 8.86 ? 118 GLU A CB 1 5: ATOM 936 C CG . GLU A 1 118 ? 28.227 10.234 34.427 1.00 9.64 ? 118 GLU A CG 1 5: ATOM 937 C CD . GLU A 1 118 ? 28.770 9.370 33.310 1.00 13.39 ? 118 GLU A CD 1 5: ATOM 938 O OE1 . GLU A 1 118 ? 28.036 9.043 32.355 1.00 11.90 ? 118 GLU A OE1 1 5: ATOM 939 O OE2 . GLU A 1 118 ? 29.956 8.998 33.405 1.00 16.59 ? 118 GLU A OE2 1 5: ATOM 940 N N . LEU A 1 119 ? 24.732 12.884 34.269 1.00 7.57 ? 119 LEU A N 1 5: ATOM 941 C CA . LEU A 1 119 ? 23.467 13.513 33.917 1.00 6.94 ? 119 LEU A CA 1 5: ATOM 942 C C . LEU A 1 119 ? 23.189 13.277 32.431 1.00 8.29 ? 119 LEU A C 1 5: ATOM 943 O O . LEU A 1 119 ? 24.070 13.506 31.593 1.00 8.23 ? 119 LEU A O 1 5: ATOM 944 C CB . LEU A 1 119 ? 23.556 15.023 34.184 1.00 7.83 ? 119 LEU A CB 1 5: ATOM 945 C CG . LEU A 1 119 ? 22.417 15.972 33.810 1.00 9.54 ? 119 LEU A CG 1 5: ATOM 946 C CD1 . LEU A 1 119 ? 21.213 15.661 34.618 1.00 11.05 ? 119 LEU A CD1 1 5: ATOM 947 C CD2 . LEU A 1 119 ? 22.822 17.421 34.066 1.00 12.54 ? 119 LEU A CD2 1 5: ATOM 948 N N . ILE A 1 120 ? 22.010 12.743 32.119 1.00 6.17 ? 120 ILE A N 1 5: ATOM 949 C CA . ILE A 1 120 ? 21.638 12.529 30.730 1.00 6.22 ? 120 ILE A CA 1 5: ATOM 950 C C . ILE A 1 120 ? 20.527 13.511 30.354 1.00 7.47 ? 120 ILE A C 1 5: ATOM 951 O O . ILE A 1 120 ? 19.493 13.580 31.036 1.00 6.54 ? 120 ILE A O 1 5: ATOM 952 C CB . ILE A 1 120 ? 21.103 11.118 30.485 1.00 7.19 ? 120 ILE A CB 1 5: ATOM 953 C CG1 . ILE A 1 120 ? 22.171 10.070 30.801 1.00 8.26 ? 120 ILE A CG1 1 5: ATOM 954 C CG2 . ILE A 1 120 ? 20.556 11.003 29.047 1.00 6.54 ? 120 ILE A CG2 1 5: ATOM 955 C CD1 . ILE A 1 120 ? 21.668 8.658 30.600 1.00 9.35 ? 120 ILE A CD1 1 5: ATOM 956 N N . LEU A 1 121 ? 20.771 14.301 29.306 1.00 6.41 ? 121 LEU A N 1 5: ATOM 957 C CA . LEU A 1 121 ? 19.783 15.236 28.779 1.00 6.25 ? 121 LEU A CA 1 5: ATOM 958 C C . LEU A 1 121 ? 19.299 14.693 27.426 1.00 7.41 ? 121 LEU A C 1 5: ATOM 959 O O . LEU A 1 121 ? 20.115 14.242 26.619 1.00 6.01 ? 121 LEU A O 1 5: ATOM 960 C CB . LEU A 1 121 ? 20.400 16.624 28.526 1.00 7.37 ? 121 LEU A CB 1 5: ATOM 961 C CG . LEU A 1 121 ? 19.607 17.580 27.597 1.00 7.96 ? 121 LEU A CG 1 5: ATOM 962 C CD1 . LEU A 1 121 ? 18.340 18.117 28.290 1.00 7.91 ? 121 LEU A CD1 1 5: ATOM 963 C CD2 . LEU A 1 121 ? 20.501 18.739 27.151 1.00 7.96 ? 121 LEU A CD2 1 5: ATOM 964 N N . THR A 1 122 ? 17.988 14.607 27.222 1.00 6.71 ? 122 THR A N 1 5: ATOM 965 C CA . THR A 1 122 ? 17.514 14.205 25.898 1.00 7.80 ? 122 THR A CA 1 5: ATOM 966 C C . THR A 1 122 ? 16.633 15.334 25.402 1.00 8.58 ? 122 THR A C 1 5: ATOM 967 O O . THR A 1 122 ? 15.988 16.034 26.194 1.00 7.21 ? 122 THR A O 1 5: ATOM 968 C CB . THR A 1 122 ? 16.754 12.843 25.832 1.00 7.51 ? 122 THR A CB 1 5: ATOM 969 O OG1 . THR A 1 122 ? 15.422 12.992 26.313 1.00 9.27 ? 122 THR A OG1 1 5: ATOM 970 C CG2 . THR A 1 122 ? 17.484 11.759 26.622 1.00 7.86 ? 122 THR A CG2 1 5: ATOM 971 N N . MET A 1 123 ? 16.732 15.613 24.110 1.00 7.87 ? 123 MET A N 1 5: ATOM 972 C CA . MET A 1 123 ? 15.904 16.643 23.494 1.00 9.22 ? 123 MET A CA 1 5: ATOM 973 C C . MET A 1 123 ? 15.194 15.950 22.337 1.00 8.66 ? 123 MET A C 1 5: ATOM 974 O O . MET A 1 123 ? 15.828 15.189 21.601 1.00 8.09 ? 123 MET A O 1 5: ATOM 975 C CB . MET A 1 123 ? 16.760 17.818 23.019 1.00 9.37 ? 123 MET A CB 1 5: ATOM 976 C CG . MET A 1 123 ? 17.359 18.612 24.171 1.00 11.81 ? 123 MET A CG 1 5: ATOM 977 S SD . MET A 1 123 ? 18.325 20.048 23.658 1.00 16.59 ? 123 MET A SD 1 5: ATOM 978 C CE . MET A 1 123 ? 19.871 19.278 23.173 1.00 14.10 ? 123 MET A CE 1 5: ATOM 979 N N . THR A 1 124 ? 13.895 16.195 22.186 1.00 7.20 ? 124 THR A N 1 5: ATOM 980 C CA . THR A 1 124 ? 13.133 15.534 21.134 1.00 9.54 ? 124 THR A CA 1 5: ATOM 981 C C . THR A 1 124 ? 12.407 16.513 20.222 1.00 10.12 ? 124 THR A C 1 5: ATOM 982 O O . THR A 1 124 ? 11.941 17.563 20.665 1.00 9.54 ? 124 THR A O 1 5: ATOM 983 C CB . THR A 1 124 ? 12.073 14.552 21.756 1.00 10.74 ? 124 THR A CB 1 5: ATOM 984 O OG1 . THR A 1 124 ? 12.740 13.544 22.535 1.00 11.99 ? 124 THR A OG1 1 5: ATOM 985 C CG2 . THR A 1 124 ? 11.247 13.865 20.679 1.00 11.66 ? 124 THR A CG2 1 5: ATOM 986 N N . ALA A 1 125 ? 12.346 16.167 18.935 1.00 11.06 ? 125 ALA A N 1 5: ATOM 987 C CA . ALA A 1 125 ? 11.634 16.962 17.923 1.00 11.63 ? 125 ALA A CA 1 5: ATOM 988 C C . ALA A 1 125 ? 10.981 15.878 17.078 1.00 13.46 ? 125 ALA A C 1 5: ATOM 989 O O . ALA A 1 125 ? 11.669 15.144 16.352 1.00 13.11 ? 125 ALA A O 1 5: ATOM 990 C CB . ALA A 1 125 ? 12.603 17.786 17.091 1.00 13.16 ? 125 ALA A CB 1 5: ATOM 991 N N . ASP A 1 126 ? 9.664 15.754 17.216 1.00 14.63 ? 126 ASP A N 1 5: ATOM 992 C CA . ASP A 1 126 ? 8.901 14.721 16.536 1.00 17.86 ? 126 ASP A CA 1 5: ATOM 993 C C . ASP A 1 126 ? 9.512 13.364 16.905 1.00 18.66 ? 126 ASP A C 1 5: ATOM 994 O O . ASP A 1 126 ? 9.519 13.006 18.080 1.00 19.38 ? 126 ASP A O 1 5: ATOM 995 C CB . ASP A 1 126 ? 8.835 14.982 15.023 1.00 18.40 ? 126 ASP A CB 1 5: ATOM 996 C CG . ASP A 1 126 ? 7.786 16.032 14.660 1.00 22.34 ? 126 ASP A CG 1 5: ATOM 997 O OD1 . ASP A 1 126 ? 6.800 16.198 15.422 1.00 23.23 ? 126 ASP A OD1 1 5: ATOM 998 O OD2 . ASP A 1 126 ? 7.940 16.702 13.621 1.00 24.32 ? 126 ASP A OD2 1 5: ATOM 999 N N . ASP A 1 127 ? 10.064 12.629 15.945 1.00 20.19 ? 127 ASP A N 1 5: ATOM 1000 C CA . ASP A 1 127 ? 10.656 11.333 16.271 1.00 21.56 ? 127 ASP A CA 1 5: ATOM 1001 C C . ASP A 1 127 ? 12.175 11.279 16.416 1.00 18.85 ? 127 ASP A C 1 5: ATOM 1002 O O . ASP A 1 127 ? 12.732 10.219 16.657 1.00 20.67 ? 127 ASP A O 1 5: ATOM 1003 C CB . ASP A 1 127 ? 10.178 10.263 15.303 1.00 26.47 ? 127 ASP A CB 1 5: ATOM 1004 C CG . ASP A 1 127 ? 9.043 9.450 15.880 1.00 33.21 ? 127 ASP A CG 1 5: ATOM 1005 O OD1 . ASP A 1 127 ? 7.892 9.959 15.934 1.00 36.08 ? 127 ASP A OD1 1 5: ATOM 1006 O OD2 . ASP A 1 127 ? 9.318 8.308 16.318 1.00 38.35 ? 127 ASP A OD2 1 5: ATOM 1007 N N . VAL A 1 128 ? 12.836 12.418 16.281 1.00 15.22 ? 128 VAL A N 1 5: ATOM 1008 C CA . VAL A 1 128 ? 14.286 12.486 16.407 1.00 12.83 ? 128 VAL A CA 1 5: ATOM 1009 C C . VAL A 1 128 ? 14.681 12.843 17.835 1.00 11.58 ? 128 VAL A C 1 5: ATOM 1010 O O . VAL A 1 128 ? 14.176 13.811 18.408 1.00 9.74 ? 128 VAL A O 1 5: ATOM 1011 C CB . VAL A 1 128 ? 14.864 13.503 15.423 1.00 12.79 ? 128 VAL A CB 1 5: ATOM 1012 C CG1 . VAL A 1 128 ? 16.338 13.757 15.706 1.00 12.93 ? 128 VAL A CG1 1 5: ATOM 1013 C CG2 . VAL A 1 128 ? 14.677 12.968 14.005 1.00 14.30 ? 128 VAL A CG2 1 5: ATOM 1014 N N . VAL A 1 129 ? 15.586 12.051 18.397 1.00 9.29 ? 129 VAL A N 1 5: ATOM 1015 C CA . VAL A 1 129 ? 16.054 12.257 19.761 1.00 7.95 ? 129 VAL A CA 1 5: ATOM 1016 C C . VAL A 1 129 ? 17.558 12.546 19.842 1.00 7.49 ? 129 VAL A C 1 5: ATOM 1017 O O . VAL A 1 129 ? 18.374 11.816 19.276 1.00 8.73 ? 129 VAL A O 1 5: ATOM 1018 C CB . VAL A 1 129 ? 15.764 11.007 20.617 1.00 9.43 ? 129 VAL A CB 1 5: ATOM 1019 C CG1 . VAL A 1 129 ? 16.153 11.253 22.076 1.00 9.09 ? 129 VAL A CG1 1 5: ATOM 1020 C CG2 . VAL A 1 129 ? 14.293 10.610 20.495 1.00 9.45 ? 129 VAL A CG2 1 5: ATOM 1021 N N . CYS A 1 130 ? 17.912 13.630 20.534 1.00 7.54 ? 130 CYS A N 1 5: ATOM 1022 C CA . CYS A 1 130 ? 19.305 14.010 20.756 1.00 6.47 ? 130 CYS A CA 1 5: ATOM 1023 C C . CYS A 1 130 ? 19.670 13.627 22.200 1.00 6.61 ? 130 CYS A C 1 5: ATOM 1024 O O . CYS A 1 130 ? 18.955 13.992 23.135 1.00 7.53 ? 130 CYS A O 1 5: ATOM 1025 C CB . CYS A 1 130 ? 19.485 15.517 20.544 1.00 6.05 ? 130 CYS A CB 1 5: ATOM 1026 S SG . CYS A 1 130 ? 21.063 16.183 21.077 1.00 8.82 ? 130 CYS A SG 1 5: ATOM 1027 N N . THR A 1 131 ? 20.786 12.925 22.372 1.00 6.58 ? 131 THR A N 1 5: ATOM 1028 C CA . THR A 1 131 ? 21.241 12.462 23.693 1.00 5.93 ? 131 THR A CA 1 5: ATOM 1029 C C . THR A 1 131 ? 22.569 13.102 24.054 1.00 6.18 ? 131 THR A C 1 5: ATOM 1030 O O . THR A 1 131 ? 23.528 13.003 23.294 1.00 5.77 ? 131 THR A O 1 5: ATOM 1031 C CB . THR A 1 131 ? 21.419 10.914 23.699 1.00 6.63 ? 131 THR A CB 1 5: ATOM 1032 O OG1 . THR A 1 131 ? 20.199 10.299 23.289 1.00 7.60 ? 131 THR A OG1 1 5: ATOM 1033 C CG2 . THR A 1 131 ? 21.763 10.399 25.091 1.00 7.76 ? 131 THR A CG2 1 5: ATOM 1034 N N . ARG A 1 132 ? 22.624 13.780 25.202 1.00 6.29 ? 132 ARG A N 1 5: ATOM 1035 C CA . ARG A 1 132 ? 23.853 14.429 25.660 1.00 7.67 ? 132 ARG A CA 1 5: ATOM 1036 C C . ARG A 1 132 ? 24.108 13.960 27.093 1.00 7.19 ? 132 ARG A C 1 5: ATOM 1037 O O . ARG A 1 132 ? 23.184 13.895 27.902 1.00 8.65 ? 132 ARG A O 1 5: ATOM 1038 C CB . ARG A 1 132 ? 23.719 15.957 25.621 1.00 9.67 ? 132 ARG A CB 1 5: ATOM 1039 C CG . ARG A 1 132 ? 22.945 16.470 24.429 1.00 15.02 ? 132 ARG A CG 1 5: ATOM 1040 C CD . ARG A 1 132 ? 23.781 17.260 23.476 1.00 16.80 ? 132 ARG A CD 1 5: ATOM 1041 N NE . ARG A 1 132 ? 24.140 18.580 23.984 1.00 12.48 ? 132 ARG A NE 1 5: ATOM 1042 C CZ . ARG A 1 132 ? 25.030 19.377 23.395 1.00 12.93 ? 132 ARG A CZ 1 5: ATOM 1043 N NH1 . ARG A 1 132 ? 25.641 19.005 22.279 1.00 13.84 ? 132 ARG A NH1 1 5: ATOM 1044 N NH2 . ARG A 1 132 ? 25.398 20.506 23.973 1.00 11.57 ? 132 ARG A NH2 1 5: ATOM 1045 N N . VAL A 1 133 ? 25.359 13.633 27.397 1.00 5.99 ? 133 VAL A N 1 5: ATOM 1046 C CA . VAL A 1 133 ? 25.739 13.124 28.719 1.00 5.92 ? 133 VAL A CA 1 5: ATOM 1047 C C . VAL A 1 133 ? 26.773 14.055 29.345 1.00 5.85 ? 133 VAL A C 1 5: ATOM 1048 O O . VAL A 1 133 ? 27.713 14.492 28.681 1.00 5.50 ? 133 VAL A O 1 5: ATOM 1049 C CB . VAL A 1 133 ? 26.333 11.698 28.608 1.00 6.37 ? 133 VAL A CB 1 5: ATOM 1050 C CG1 . VAL A 1 133 ? 26.609 11.120 29.988 1.00 7.95 ? 133 VAL A CG1 1 5: ATOM 1051 C CG2 . VAL A 1 133 ? 25.385 10.782 27.832 1.00 6.46 ? 133 VAL A CG2 1 5: ATOM 1052 N N . TYR A 1 134 ? 26.619 14.337 30.635 1.00 5.35 ? 134 TYR A N 1 5: ATOM 1053 C CA . TYR A 1 134 ? 27.538 15.228 31.322 1.00 4.57 ? 134 TYR A CA 1 5: ATOM 1054 C C . TYR A 1 134 ? 28.014 14.611 32.617 1.00 5.30 ? 134 TYR A C 1 5: ATOM 1055 O O . TYR A 1 134 ? 27.371 13.712 33.165 1.00 3.92 ? 134 TYR A O 1 5: ATOM 1056 C CB . TYR A 1 134 ? 26.846 16.550 31.686 1.00 6.84 ? 134 TYR A CB 1 5: ATOM 1057 C CG . TYR A 1 134 ? 26.118 17.251 30.574 1.00 8.89 ? 134 TYR A CG 1 5: ATOM 1058 C CD1 . TYR A 1 134 ? 24.901 16.762 30.122 1.00 10.29 ? 134 TYR A CD1 1 5: ATOM 1059 C CD2 . TYR A 1 134 ? 26.628 18.406 29.992 1.00 10.49 ? 134 TYR A CD2 1 5: ATOM 1060 C CE1 . TYR A 1 134 ? 24.212 17.386 29.133 1.00 13.03 ? 134 TYR A CE1 1 5: ATOM 1061 C CE2 . TYR A 1 134 ? 25.930 19.051 28.982 1.00 12.15 ? 134 TYR A CE2 1 5: ATOM 1062 C CZ . TYR A 1 134 ? 24.723 18.517 28.567 1.00 12.80 ? 134 TYR A CZ 1 5: ATOM 1063 O OH . TYR A 1 134 ? 23.991 19.082 27.567 1.00 18.07 ? 134 TYR A OH 1 5: ATOM 1064 N N . VAL A 1 135 ? 29.113 15.158 33.119 1.00 6.63 ? 135 VAL A N 1 5: ATOM 1065 C CA . VAL A 1 135 ? 29.697 14.762 34.394 1.00 8.42 ? 135 VAL A CA 1 5: ATOM 1066 C C . VAL A 1 135 ? 30.100 16.086 35.064 1.00 9.05 ? 135 VAL A C 1 5: ATOM 1067 O O . VAL A 1 135 ? 30.340 17.086 34.385 1.00 9.02 ? 135 VAL A O 1 5: ATOM 1068 C CB . VAL A 1 135 ? 30.925 13.815 34.204 1.00 8.05 ? 135 VAL A CB 1 5: ATOM 1069 C CG1 . VAL A 1 135 ? 32.109 14.556 33.596 1.00 9.27 ? 135 VAL A CG1 1 5: ATOM 1070 C CG2 . VAL A 1 135 ? 31.304 13.151 35.533 1.00 10.37 ? 135 VAL A CG2 1 5: ATOM 1071 N N . ARG A 1 136 ? 30.117 16.133 36.390 1.00 9.57 ? 136 ARG A N 1 5: ATOM 1072 C CA . ARG A 1 136 ? 30.498 17.375 37.040 1.00 10.86 ? 136 ARG A CA 1 5: ATOM 1073 C C . ARG A 1 136 ? 31.964 17.676 36.776 1.00 11.68 ? 136 ARG A C 1 5: ATOM 1074 O O . ARG A 1 136 ? 32.782 16.765 36.686 1.00 11.35 ? 136 ARG A O 1 5: ATOM 1075 C CB . ARG A 1 136 ? 30.221 17.319 38.536 1.00 11.99 ? 136 ARG A CB 1 5: ATOM 1076 C CG . ARG A 1 136 ? 28.746 17.454 38.885 1.00 13.89 ? 136 ARG A CG 1 5: ATOM 1077 C CD . ARG A 1 136 ? 28.576 17.533 40.382 1.00 15.85 ? 136 ARG A CD 1 5: ATOM 1078 N NE . ARG A 1 136 ? 27.185 17.407 40.754 1.00 17.08 ? 136 ARG A NE 1 5: ATOM 1079 C CZ . ARG A 1 136 ? 26.561 16.245 40.926 1.00 21.69 ? 136 ARG A CZ 1 5: ATOM 1080 N NH1 . ARG A 1 136 ? 27.217 15.102 40.754 1.00 23.26 ? 136 ARG A NH1 1 5: ATOM 1081 N NH2 . ARG A 1 136 ? 25.278 16.227 41.283 1.00 22.60 ? 136 ARG A NH2 1 5: ATOM 1082 N N . GLU A 1 137 ? 32.282 18.963 36.663 1.00 15.12 ? 137 GLU A N 1 5: ATOM 1083 C CA . GLU A 1 137 ? 33.641 19.430 36.400 1.00 18.00 ? 137 GLU A CA 1 5: ATOM 1084 C C . GLU A 1 137 ? 34.615 19.038 37.493 1.00 18.96 ? 137 GLU A C 1 5: ATOM 1085 O O . GLU A 1 137 ? 34.221 19.175 38.659 1.00 17.37 ? 137 GLU A O 1 5: ATOM 1086 C CB . GLU A 1 137 ? 33.661 20.943 36.293 1.00 19.89 ? 137 GLU A CB 1 5: ATOM 1087 C CG . GLU A 1 137 ? 33.092 21.492 35.035 1.00 28.03 ? 137 GLU A CG 1 5: ATOM 1088 C CD . GLU A 1 137 ? 33.469 22.953 34.865 1.00 33.22 ? 137 GLU A CD 1 5: ATOM 1089 O OE1 . GLU A 1 137 ? 34.630 23.217 34.473 1.00 37.31 ? 137 GLU A OE1 1 5: ATOM 1090 O OE2 . GLU A 1 137 ? 32.636 23.836 35.164 1.00 36.38 ? 137 GLU A OE2 1 5: ATOM 1091 O OXT . GLU A 1 137 ? 35.776 18.680 37.173 1.00 22.23 ? 137 GLU A OXT 1 5: HETATM 1092 C C1 . RXA B 4 . ? 21.972 29.831 16.739 1.00 15.25 ? 200 RXA A C1 1 5: HETATM 1093 C C2 . RXA B 4 . ? 20.921 30.524 15.841 1.00 15.61 ? 200 RXA A C2 1 5: HETATM 1094 C C3 . RXA B 4 . ? 20.245 29.635 14.848 1.00 16.19 ? 200 RXA A C3 1 5: HETATM 1095 C C4 . RXA B 4 . ? 19.555 28.479 15.488 1.00 14.59 ? 200 RXA A C4 1 5: HETATM 1096 C C5 . RXA B 4 . ? 20.389 27.812 16.587 1.00 14.10 ? 200 RXA A C5 1 5: HETATM 1097 C C6 . RXA B 4 . ? 21.425 28.446 17.218 1.00 14.42 ? 200 RXA A C6 1 5: HETATM 1098 C C7 . RXA B 4 . ? 22.242 27.851 18.297 1.00 13.89 ? 200 RXA A C7 1 5: HETATM 1099 C C8 . RXA B 4 . ? 21.868 26.977 19.240 1.00 11.86 ? 200 RXA A C8 1 5: HETATM 1100 C C9 . RXA B 4 . ? 22.705 26.434 20.286 1.00 10.87 ? 200 RXA A C9 1 5: HETATM 1101 C C10 . RXA B 4 . ? 22.159 25.536 21.131 1.00 9.19 ? 200 RXA A C10 1 5: HETATM 1102 C C11 . RXA B 4 . ? 22.875 24.924 22.234 1.00 10.35 ? 200 RXA A C11 1 5: HETATM 1103 C C12 . RXA B 4 . ? 22.237 24.026 22.990 1.00 10.53 ? 200 RXA A C12 1 5: HETATM 1104 C C13 . RXA B 4 . ? 22.856 23.377 24.125 1.00 10.91 ? 200 RXA A C13 1 5: HETATM 1105 C C14 . RXA B 4 . ? 22.135 22.473 24.834 1.00 11.88 ? 200 RXA A C14 1 5: HETATM 1106 C C15 . RXA B 4 . ? 22.563 21.710 26.016 1.00 14.86 ? 200 RXA A C15 1 5: HETATM 1107 C C16 . RXA B 4 . ? 22.238 30.737 17.948 1.00 15.47 ? 200 RXA A C16 1 5: HETATM 1108 C C17 . RXA B 4 . ? 23.292 29.620 15.948 1.00 13.42 ? 200 RXA A C17 1 5: HETATM 1109 C C18 . RXA B 4 . ? 19.791 26.449 16.947 1.00 12.61 ? 200 RXA A C18 1 5: HETATM 1110 C C19 . RXA B 4 . ? 24.181 26.841 20.385 1.00 10.08 ? 200 RXA A C19 1 5: HETATM 1111 C C20 . RXA B 4 . ? 24.303 23.747 24.489 1.00 10.10 ? 200 RXA A C20 1 5: HETATM 1112 O O1 . RXA B 4 . ? 23.640 21.075 25.978 1.00 13.29 ? 200 RXA A O1 1 5: HETATM 1113 O O2 . RXA B 4 . ? 21.840 21.712 27.037 1.00 10.99 ? 200 RXA A O2 1 5: HETATM 1114 O O . HOH C 3 . ? 21.817 19.604 31.169 1.00 17.43 ? 300 HOH A O 1 5: HETATM 1115 O O . HOH C 3 . ? 7.617 26.892 37.107 1.00 12.66 ? 301 HOH A O 1 5: HETATM 1116 O O . HOH C 3 . ? 22.885 27.835 25.056 1.00 18.86 ? 302 HOH A O 1 5: HETATM 1117 O O . HOH C 3 . ? 30.685 27.402 22.818 1.00 14.12 ? 303 HOH A O 1 5: HETATM 1118 O O . HOH C 3 . ? 29.930 20.839 40.398 1.00 16.48 ? 304 HOH A O 1 5: HETATM 1119 O O . HOH C 3 . ? 31.492 21.096 28.452 1.00 16.65 ? 305 HOH A O 1 5: HETATM 1120 O O . HOH C 3 . ? 19.459 26.601 30.320 1.00 9.81 ? 306 HOH A O 1 5: HETATM 1121 O O . HOH C 3 . ? 19.116 26.759 22.930 1.00 22.33 ? 307 HOH A O 1 5: HETATM 1122 O O . HOH C 3 . ? 16.356 22.299 28.453 1.00 35.46 ? 308 HOH A O 1 5: HETATM 1123 O O . HOH C 3 . ? 21.823 21.939 29.734 1.00 13.95 ? 309 HOH A O 1 5: HETATM 1124 O O . HOH C 3 . ? 13.206 22.267 22.102 1.00 20.07 ? 310 HOH A O 1 5: HETATM 1125 O O . HOH C 3 . ? 30.300 22.803 12.740 1.00 24.70 ? 311 HOH A O 1 5: HETATM 1126 O O . HOH C 3 . ? 7.344 23.059 35.600 1.00 8.82 ? 312 HOH A O 1 5: HETATM 1127 O O . HOH C 3 . ? 6.876 22.668 20.375 1.00 29.74 ? 313 HOH A O 1 5: HETATM 1128 O O . HOH C 3 . ? 17.917 24.800 29.159 1.00 23.69 ? 314 HOH A O 1 5: HETATM 1129 O O . HOH C 3 . ? 37.101 16.714 38.714 1.00 19.84 ? 315 HOH A O 1 5: HETATM 1130 O O . HOH C 3 . ? 28.721 7.425 30.043 1.00 14.94 ? 316 HOH A O 1 5: HETATM 1131 O O . HOH C 3 . ? 13.212 14.450 25.193 1.00 18.03 ? 317 HOH A O 1 5: HETATM 1132 O O . HOH C 3 . ? 6.094 9.777 39.151 1.00 13.98 ? 318 HOH A O 1 5: HETATM 1133 O O . HOH C 3 . ? 19.296 10.379 13.144 1.00 27.20 ? 319 HOH A O 1 5: HETATM 1134 O O . HOH C 3 . ? 25.337 10.931 16.577 1.00 18.41 ? 320 HOH A O 1 5: HETATM 1135 O O . HOH C 3 . ? 25.244 34.269 18.193 1.00 9.65 ? 321 HOH A O 1 5: HETATM 1136 O O . HOH C 3 . ? 23.567 10.727 14.429 1.00 11.13 ? 322 HOH A O 1 5: HETATM 1137 O O . HOH C 3 . ? 17.151 12.178 30.238 1.00 11.53 ? 323 HOH A O 1 5: HETATM 1138 O O . HOH C 3 . ? 27.768 11.967 42.077 1.00 23.33 ? 324 HOH A O 1 5: HETATM 1139 O O . HOH C 3 . ? 30.270 12.554 21.386 1.00 25.05 ? 325 HOH A O 1 5: HETATM 1140 O O . HOH C 3 . ? 25.662 15.488 18.515 1.00 10.80 ? 326 HOH A O 1 5: HETATM 1141 O O . HOH C 3 . ? 4.514 21.426 18.685 1.00 45.94 ? 327 HOH A O 1 5: HETATM 1142 O O . HOH C 3 . ? 8.081 23.201 17.690 1.00 30.16 ? 328 HOH A O 1 5: HETATM 1143 O O . HOH C 3 . ? 13.242 29.389 14.924 1.00 39.93 ? 329 HOH A O 1 5: HETATM 1144 O O . HOH C 3 . ? 10.514 18.772 10.176 1.00 33.65 ? 330 HOH A O 1 5: HETATM 1145 O O . HOH C 3 . ? 10.555 13.666 26.313 1.00 32.55 ? 331 HOH A O 1 5: HETATM 1146 O O . HOH C 3 . ? 5.189 16.418 31.375 1.00 35.78 ? 332 HOH A O 1 5: HETATM 1147 O O . HOH C 3 . ? 0.738 25.633 36.349 1.00 29.00 ? 333 HOH A O 1 5: HETATM 1148 O O . HOH C 3 . ? 2.976 28.966 37.321 1.00 40.14 ? 334 HOH A O 1 5: HETATM 1149 O O . HOH C 3 . ? 6.424 28.750 38.849 1.00 32.17 ? 335 HOH A O 1 5: HETATM 1150 O O . HOH C 3 . ? 12.503 30.488 31.704 1.00 41.11 ? 336 HOH A O 1 5: HETATM 1151 O O . HOH C 3 . ? 14.979 30.157 27.559 1.00 23.78 ? 337 HOH A O 1 5: HETATM 1152 O O . HOH C 3 . ? 17.312 32.981 28.812 1.00 20.84 ? 338 HOH A O 1 5: HETATM 1153 O O . HOH C 3 . ? 29.473 25.946 34.693 1.00 29.05 ? 339 HOH A O 1 5: HETATM 1154 O O . HOH C 3 . ? 30.328 23.817 33.494 1.00 24.17 ? 340 HOH A O 1 5: HETATM 1155 O O . HOH C 3 . ? 31.158 28.144 26.433 1.00 42.66 ? 341 HOH A O 1 5: HETATM 1156 O O . HOH C 3 . ? 30.276 28.397 16.400 1.00 21.90 ? 342 HOH A O 1 5: HETATM 1157 O O . HOH C 3 . ? 19.533 23.600 26.857 1.00 21.12 ? 343 HOH A O 1 5: HETATM 1158 O O . HOH C 3 . ? 17.892 24.675 24.549 1.00 48.11 ? 344 HOH A O 1 5: HETATM 1159 O O . HOH C 3 . ? 14.211 24.152 25.435 1.00 21.09 ? 345 HOH A O 1 5: HETATM 1160 O O . HOH C 3 . ? 15.223 27.626 27.056 1.00 27.16 ? 346 HOH A O 1 5: HETATM 1161 O O . HOH C 3 . ? 3.502 22.911 43.083 1.00 30.15 ? 347 HOH A O 1 5: HETATM 1162 O O . HOH C 3 . ? 20.610 7.668 40.212 1.00 49.06 ? 348 HOH A O 1 5: HETATM 1163 O O . HOH C 3 . ? 24.813 2.899 36.403 1.00 48.98 ? 349 HOH A O 1 5: HETATM 1164 O O . HOH C 3 . ? 29.900 5.163 26.918 1.00 23.60 ? 350 HOH A O 1 5: HETATM 1165 O O . HOH C 3 . ? 14.333 5.466 42.757 1.00 22.90 ? 351 HOH A O 1 5: HETATM 1166 O O . HOH C 3 . ? 8.914 5.771 35.515 1.00 35.92 ? 352 HOH A O 1 5: HETATM 1167 O O . HOH C 3 . ? 14.519 28.906 40.193 1.00 28.73 ? 353 HOH A O 1 5: HETATM 1168 O O . HOH C 3 . ? 17.573 20.203 47.080 1.00 37.63 ? 354 HOH A O 1 5: HETATM 1169 O O . HOH C 3 . ? 13.324 32.251 34.152 1.00 47.79 ? 355 HOH A O 1 5: HETATM 1170 O O . HOH C 3 . ? 12.491 24.840 7.594 1.00 39.45 ? 356 HOH A O 1 5: HETATM 1171 O O . HOH C 3 . ? 25.066 15.777 15.214 1.00 27.39 ? 357 HOH A O 1 5: HETATM 1172 O O . HOH C 3 . ? 27.138 17.638 17.834 1.00 45.12 ? 358 HOH A O 1 5: HETATM 1173 O O . HOH C 3 . ? 27.611 19.792 19.503 1.00 24.45 ? 359 HOH A O 1 5: HETATM 1174 O O . HOH C 3 . ? 11.358 8.880 19.119 1.00 24.31 ? 360 HOH A O 1 5: HETATM 1175 O O . HOH C 3 . ? 16.252 27.169 24.557 1.00 25.40 ? 361 HOH A O 1 5: HETATM 1176 O O . HOH C 3 . ? 22.049 27.870 4.565 1.00 25.37 ? 362 HOH A O 1 5: HETATM 1177 O O . HOH C 3 . ? 11.533 6.689 34.501 1.00 29.92 ? 363 HOH A O 1 5: HETATM 1178 O O . HOH C 3 . ? 13.269 4.551 36.338 1.00 45.75 ? 364 HOH A O 1 5: HETATM 1179 O O . HOH C 3 . ? 23.149 9.493 41.173 1.00 30.10 ? 365 HOH A O 1 5: HETATM 1180 O O . HOH C 3 . ? 21.090 12.171 43.973 1.00 27.97 ? 366 HOH A O 1 5: HETATM 1181 O O . HOH C 3 . ? 11.884 13.399 42.560 1.00 23.28 ? 367 HOH A O 1 5: HETATM 1182 O O . HOH C 3 . ? 29.542 17.520 20.025 1.00 38.32 ? 368 HOH A O 1 5: HETATM 1183 O O . HOH C 3 . ? 31.058 17.427 22.538 1.00 37.85 ? 369 HOH A O 1 5: HETATM 1184 O O . HOH C 3 . ? 31.928 9.444 23.294 1.00 46.07 ? 370 HOH A O 1 5: HETATM 1185 O O . HOH C 3 . ? 25.699 10.933 9.557 1.00 44.12 ? 371 HOH A O 1 5: HETATM 1186 O O . HOH C 3 . ? 26.533 13.428 16.334 1.00 45.21 ? 372 HOH A O 1 5: HETATM 1187 O O . HOH C 3 . ? 27.078 16.850 13.245 1.00 39.52 ? 373 HOH A O 1 5: HETATM 1188 O O . HOH C 3 . ? 20.596 32.070 6.807 1.00 36.38 ? 374 HOH A O 1 5: HETATM 1189 O O . HOH C 3 . ? 17.126 28.421 9.515 1.00 23.81 ? 375 HOH A O 1 5: HETATM 1190 O O . HOH C 3 . ? 16.626 32.383 11.231 1.00 20.11 ? 376 HOH A O 1 5: HETATM 1191 O O . HOH C 3 . ? 6.046 30.510 19.639 1.00 29.02 ? 377 HOH A O 1 5: HETATM 1192 O O . HOH C 3 . ? 9.543 16.072 11.145 1.00 50.91 ? 378 HOH A O 1 5: HETATM 1193 O O . HOH C 3 . ? 8.174 14.289 20.240 1.00 54.21 ? 379 HOH A O 1 5: HETATM 1194 O O . HOH C 3 . ? 11.561 10.834 22.873 1.00 43.23 ? 380 HOH A O 1 5: HETATM 1195 O O . HOH C 3 . ? 5.486 15.385 24.922 1.00 50.19 ? 381 HOH A O 1 5: HETATM 1196 O O . HOH C 3 . ? 6.038 21.424 43.276 1.00 46.64 ? 382 HOH A O 1 5: HETATM 1197 O O . HOH C 3 . ? 34.144 19.165 27.284 1.00 41.41 ? 383 HOH A O 1 5: HETATM 1198 O O . HOH C 3 . ? 16.916 27.142 42.621 1.00 29.32 ? 384 HOH A O 1 5: HETATM 1199 O O . HOH C 3 . ? 25.509 24.918 41.520 1.00 32.12 ? 385 HOH A O 1 5: HETATM 1200 O O . HOH C 3 . ? 31.446 7.504 31.389 1.00 28.93 ? 386 HOH A O 1 5: HETATM 1201 O O . HOH C 3 . ? 18.212 20.893 5.892 1.00 29.90 ? 387 HOH A O 1 5: HETATM 1202 O O . HOH C 3 . ? 15.148 27.608 7.685 1.00 30.91 ? 388 HOH A O 1 5: HETATM 1203 O O . HOH C 3 . ? 2.656 23.148 20.117 1.00 35.98 ? 389 HOH A O 1 5: HETATM 1204 O O . HOH C 3 . ? 3.100 22.690 28.640 1.00 31.31 ? 390 HOH A O 1 5: HETATM 1205 O O . HOH C 3 . ? 13.699 19.720 21.819 1.00 26.56 ? 391 HOH A O 1 5: HETATM 1206 O O . HOH C 3 . ? 26.833 28.283 32.272 1.00 31.48 ? 392 HOH A O 1 5: HETATM 1207 O O . HOH C 3 . ? 20.458 26.214 25.811 1.00 24.39 ? 393 HOH A O 1 5: HETATM 1208 O O . HOH C 3 . ? 32.304 27.731 18.152 1.00 41.66 ? 394 HOH A O 1 5: HETATM 1209 O O . HOH C 3 . ? 24.283 13.868 42.687 1.00 35.59 ? 395 HOH A O 1 5: HETATM 1210 O O . HOH C 3 . ? 11.833 12.657 45.160 1.00 38.30 ? 396 HOH A O 1 5: HETATM 1211 O O . HOH C 3 . ? 1.988 27.992 43.589 1.00 33.97 ? 397 HOH A O 1 5: HETATM 1212 O O . HOH C 3 . ? 32.913 22.982 40.176 1.00 39.26 ? 398 HOH A O 1 5: HETATM 1213 O O . HOH C 3 . ? 32.435 20.043 40.169 1.00 33.87 ? 399 HOH A O 1 5: # 5: loop_ 5: _pdbx_validate_torsion.id 5: _pdbx_validate_torsion.PDB_model_num 5: _pdbx_validate_torsion.auth_comp_id 5: _pdbx_validate_torsion.auth_asym_id 5: _pdbx_validate_torsion.auth_seq_id 5: _pdbx_validate_torsion.PDB_ins_code 5: _pdbx_validate_torsion.label_alt_id 5: _pdbx_validate_torsion.phi 5: _pdbx_validate_torsion.psi 5: 1 1 GLU A 73 ? ? -144.94 -154.28 5: 2 1 ASP A 126 ? ? 55.69 -115.96 5: # 5: loop_ 5: _struct_site_gen.id 5: _struct_site_gen.site_id 5: _struct_site_gen.pdbx_num_res 5: _struct_site_gen.label_comp_id 5: _struct_site_gen.label_asym_id 5: _struct_site_gen.label_seq_id 5: _struct_site_gen.pdbx_auth_ins_code 5: _struct_site_gen.auth_comp_id 5: _struct_site_gen.auth_asym_id 5: _struct_site_gen.auth_seq_id 5: _struct_site_gen.label_atom_id 5: _struct_site_gen.label_alt_id 5: _struct_site_gen.symmetry 5: _struct_site_gen.details 5: _struct_site_gen.auth_atom_id 5: 1 AC1 10 GLU A 13 ? GLU A 13 . ? 3_655 ? ? 5: 2 AC1 10 ALA A 32 ? ALA A 32 . ? 1_555 ? ? 5: 3 AC1 10 THR A 54 ? THR A 54 . ? 1_555 ? ? 5: 4 AC1 10 VAL A 58 ? VAL A 58 . ? 1_555 ? ? 5: 5 AC1 10 VAL A 76 ? VAL A 76 . ? 1_555 ? ? 5: 6 AC1 10 LEU A 121 ? LEU A 121 . ? 1_555 ? ? 5: 7 AC1 10 ARG A 132 ? ARG A 132 . ? 1_555 ? ? 5: 8 AC1 10 TYR A 134 ? TYR A 134 . ? 1_555 ? ? 5: 9 AC1 10 HOH C . ? HOH A 309 . ? 1_555 ? ? 5: 10 AC1 10 HOH C . ? HOH A 343 . ? 1_555 ? ? 5: # 5: loop_ 5: _pdbx_nonpoly_scheme.asym_id 5: _pdbx_nonpoly_scheme.entity_id 5: _pdbx_nonpoly_scheme.mon_id 5: _pdbx_nonpoly_scheme.ndb_seq_num 5: _pdbx_nonpoly_scheme.pdb_seq_num 5: _pdbx_nonpoly_scheme.auth_seq_num 5: _pdbx_nonpoly_scheme.pdb_mon_id 5: _pdbx_nonpoly_scheme.auth_mon_id 5: _pdbx_nonpoly_scheme.pdb_strand_id 5: _pdbx_nonpoly_scheme.pdb_ins_code 5: B 4 RXA 1 200 200 RXA RXA A . 5: C 3 HOH 1 300 300 HOH HOH A . 5: C 3 HOH 2 301 301 HOH HOH A . 5: C 3 HOH 3 302 302 HOH HOH A . 5: C 3 HOH 4 303 303 HOH HOH A . 5: C 3 HOH 5 304 304 HOH HOH A . 5: C 3 HOH 6 305 305 HOH HOH A . 5: C 3 HOH 7 306 306 HOH HOH A . 5: C 3 HOH 8 307 307 HOH HOH A . 5: C 3 HOH 9 308 308 HOH HOH A . 5: C 3 HOH 10 309 309 HOH HOH A . 5: C 3 HOH 11 310 310 HOH HOH A . 5: C 3 HOH 12 311 311 HOH HOH A . 5: C 3 HOH 13 312 312 HOH HOH A . 5: C 3 HOH 14 313 313 HOH HOH A . 5: C 3 HOH 15 314 314 HOH HOH A . 5: C 3 HOH 16 315 315 HOH HOH A . 5: C 3 HOH 17 316 316 HOH HOH A . 5: C 3 HOH 18 317 317 HOH HOH A . 5: C 3 HOH 19 318 318 HOH HOH A . 5: C 3 HOH 20 319 319 HOH HOH A . 5: C 3 HOH 21 320 320 HOH HOH A . 5: C 3 HOH 22 321 321 HOH HOH A . 5: C 3 HOH 23 322 322 HOH HOH A . 5: C 3 HOH 24 323 323 HOH HOH A . 5: C 3 HOH 25 324 324 HOH HOH A . 5: C 3 HOH 26 325 325 HOH HOH A . 5: C 3 HOH 27 326 326 HOH HOH A . 5: C 3 HOH 28 327 327 HOH HOH A . 5: C 3 HOH 29 328 328 HOH HOH A . 5: C 3 HOH 30 329 329 HOH HOH A . 5: C 3 HOH 31 330 330 HOH HOH A . 5: C 3 HOH 32 331 331 HOH HOH A . 5: C 3 HOH 33 332 332 HOH HOH A . 5: C 3 HOH 34 333 333 HOH HOH A . 5: C 3 HOH 35 334 334 HOH HOH A . 5: C 3 HOH 36 335 335 HOH HOH A . 5: C 3 HOH 37 336 336 HOH HOH A . 5: C 3 HOH 38 337 337 HOH HOH A . 5: C 3 HOH 39 338 338 HOH HOH A . 5: C 3 HOH 40 339 339 HOH HOH A . 5: C 3 HOH 41 340 340 HOH HOH A . 5: C 3 HOH 42 341 341 HOH HOH A . 5: C 3 HOH 43 342 342 HOH HOH A . 5: C 3 HOH 44 343 343 HOH HOH A . 5: C 3 HOH 45 344 344 HOH HOH A . 5: C 3 HOH 46 345 345 HOH HOH A . 5: C 3 HOH 47 346 346 HOH HOH A . 5: C 3 HOH 48 347 347 HOH HOH A . 5: C 3 HOH 49 348 348 HOH HOH A . 5: C 3 HOH 50 349 349 HOH HOH A . 5: C 3 HOH 51 350 350 HOH HOH A . 5: C 3 HOH 52 351 351 HOH HOH A . 5: C 3 HOH 53 352 352 HOH HOH A . 5: C 3 HOH 54 353 353 HOH HOH A . 5: C 3 HOH 55 354 354 HOH HOH A . 5: C 3 HOH 56 355 355 HOH HOH A . 5: C 3 HOH 57 356 356 HOH HOH A . 5: C 3 HOH 58 357 357 HOH HOH A . 5: C 3 HOH 59 358 358 HOH HOH A . 5: C 3 HOH 60 359 359 HOH HOH A . 5: C 3 HOH 61 360 360 HOH HOH A . 5: C 3 HOH 62 361 361 HOH HOH A . 5: C 3 HOH 63 362 362 HOH HOH A . 5: C 3 HOH 64 363 363 HOH HOH A . 5: C 3 HOH 65 364 364 HOH HOH A . 5: C 3 HOH 66 365 365 HOH HOH A . 5: C 3 HOH 67 366 366 HOH HOH A . 5: C 3 HOH 68 367 367 HOH HOH A . 5: C 3 HOH 69 368 368 HOH HOH A . 5: C 3 HOH 70 369 369 HOH HOH A . 5: C 3 HOH 71 370 370 HOH HOH A . 5: C 3 HOH 72 371 371 HOH HOH A . 5: C 3 HOH 73 372 372 HOH HOH A . 5: C 3 HOH 74 373 373 HOH HOH A . 5: C 3 HOH 75 374 374 HOH HOH A . 5: C 3 HOH 76 375 375 HOH HOH A . 5: C 3 HOH 77 376 376 HOH HOH A . 5: C 3 HOH 78 377 377 HOH HOH A . 5: C 3 HOH 79 378 378 HOH HOH A . 5: C 3 HOH 80 379 379 HOH HOH A . 5: C 3 HOH 81 380 380 HOH HOH A . 5: C 3 HOH 82 381 381 HOH HOH A . 5: C 3 HOH 83 382 382 HOH HOH A . 5: C 3 HOH 84 383 383 HOH HOH A . 5: C 3 HOH 85 384 384 HOH HOH A . 5: C 3 HOH 86 385 385 HOH HOH A . 5: C 3 HOH 87 386 386 HOH HOH A . 5: C 3 HOH 88 387 387 HOH HOH A . 5: C 3 HOH 89 388 388 HOH HOH A . 5: C 3 HOH 90 389 389 HOH HOH A . 5: C 3 HOH 91 390 390 HOH HOH A . 5: C 3 HOH 92 391 391 HOH HOH A . 5: C 3 HOH 93 392 392 HOH HOH A . 5: C 3 HOH 94 393 393 HOH HOH A . 5: C 3 HOH 95 394 394 HOH HOH A . 5: C 3 HOH 96 395 395 HOH HOH A . 5: C 3 HOH 97 396 396 HOH HOH A . 5: C 3 HOH 98 397 397 HOH HOH A . 5: C 3 HOH 99 398 398 HOH HOH A . 5: C 3 HOH 100 399 399 HOH HOH A . 5: # 5: loop_ 5: _pdbx_entity_nonpoly.entity_id 5: _pdbx_entity_nonpoly.name 5: _pdbx_entity_nonpoly.comp_id 5: 3 water HOH 5: 4 'RENAMED RETINOIC ACID' RXA 5: # 5: _struct_ref_seq.align_id 1 5: _struct_ref_seq.ref_id 1 5: _struct_ref_seq.pdbx_PDB_id_code 1CBS 5: _struct_ref_seq.pdbx_strand_id A 5: _struct_ref_seq.seq_align_beg 1 5: _struct_ref_seq.pdbx_seq_align_beg_ins_code ? 5: _struct_ref_seq.seq_align_end 137 5: _struct_ref_seq.pdbx_seq_align_end_ins_code ? 5: _struct_ref_seq.pdbx_db_accession P29373 5: _struct_ref_seq.db_align_beg 1 5: _struct_ref_seq.pdbx_db_align_beg_ins_code ? 5: _struct_ref_seq.db_align_end 137 5: _struct_ref_seq.pdbx_db_align_end_ins_code ? 5: _struct_ref_seq.pdbx_auth_seq_align_beg 1 5: _struct_ref_seq.pdbx_auth_seq_align_end 137 5: # 5: loop_ 5: _struct_sheet_range.sheet_id 5: _struct_sheet_range.id 5: _struct_sheet_range.beg_label_comp_id 5: _struct_sheet_range.beg_label_asym_id 5: _struct_sheet_range.beg_label_seq_id 5: _struct_sheet_range.pdbx_beg_PDB_ins_code 5: _struct_sheet_range.end_label_comp_id 5: _struct_sheet_range.end_label_asym_id 5: _struct_sheet_range.end_label_seq_id 5: _struct_sheet_range.pdbx_end_PDB_ins_code 5: _struct_sheet_range.beg_auth_comp_id 5: _struct_sheet_range.beg_auth_asym_id 5: _struct_sheet_range.beg_auth_seq_id 5: _struct_sheet_range.end_auth_comp_id 5: _struct_sheet_range.end_auth_asym_id 5: _struct_sheet_range.end_auth_seq_id 5: A 1 THR A 60 ? LYS A 66 ? THR A 60 LYS A 66 5: A 2 THR A 49 ? SER A 55 ? THR A 49 SER A 55 5: A 3 ALA A 40 ? GLU A 46 ? ALA A 40 GLU A 46 5: A 4 GLY A 5 ? GLU A 13 ? GLY A 5 GLU A 13 5: A 5 VAL A 128 ? ARG A 136 ? VAL A 128 ARG A 136 5: A 6 LEU A 119 ? ALA A 125 ? LEU A 119 ALA A 125 5: A 7 THR A 107 ? LEU A 113 ? THR A 107 LEU A 113 5: A 8 LYS A 92 ? LEU A 99 ? LYS A 92 LEU A 99 5: A 9 PRO A 80 ? SER A 89 ? PRO A 80 SER A 89 5: A 10 PHE A 71 ? GLN A 74 ? PHE A 71 GLN A 74 5: # 5: loop_ 5: _struct_conf.conf_type_id 5: _struct_conf.id 5: _struct_conf.pdbx_PDB_helix_id 5: _struct_conf.beg_label_comp_id 5: _struct_conf.beg_label_asym_id 5: _struct_conf.beg_label_seq_id 5: _struct_conf.pdbx_beg_PDB_ins_code 5: _struct_conf.end_label_comp_id 5: _struct_conf.end_label_asym_id 5: _struct_conf.end_label_seq_id 5: _struct_conf.pdbx_end_PDB_ins_code 5: _struct_conf.beg_auth_comp_id 5: _struct_conf.beg_auth_asym_id 5: _struct_conf.beg_auth_seq_id 5: _struct_conf.end_auth_comp_id 5: _struct_conf.end_auth_asym_id 5: _struct_conf.end_auth_seq_id 5: _struct_conf.pdbx_PDB_helix_class 5: _struct_conf.details 5: _struct_conf.pdbx_PDB_helix_length 5: HELX_P HELX_P1 1 ASN A 14 ? LEU A 22 ? ASN A 14 LEU A 22 1 ? 9 5: HELX_P HELX_P2 2 ASN A 25 ? SER A 37 ? ASN A 25 SER A 37 1 ? 13 5: # 5: loop_ 5: _struct_sheet_order.sheet_id 5: _struct_sheet_order.range_id_1 5: _struct_sheet_order.range_id_2 5: _struct_sheet_order.offset 5: _struct_sheet_order.sense 5: A 1 2 ? anti-parallel 5: A 2 3 ? anti-parallel 5: A 3 4 ? anti-parallel 5: A 4 5 ? anti-parallel 5: A 5 6 ? anti-parallel 5: A 6 7 ? anti-parallel 5: A 7 8 ? anti-parallel 5: A 8 9 ? anti-parallel 5: A 9 10 ? anti-parallel 5: # 5: loop_ 5: _pdbx_struct_sheet_hbond.sheet_id 5: _pdbx_struct_sheet_hbond.range_id_1 5: _pdbx_struct_sheet_hbond.range_id_2 5: _pdbx_struct_sheet_hbond.range_1_label_atom_id 5: _pdbx_struct_sheet_hbond.range_1_label_comp_id 5: _pdbx_struct_sheet_hbond.range_1_label_asym_id 5: _pdbx_struct_sheet_hbond.range_1_label_seq_id 5: _pdbx_struct_sheet_hbond.range_1_PDB_ins_code 5: _pdbx_struct_sheet_hbond.range_1_auth_atom_id 5: _pdbx_struct_sheet_hbond.range_1_auth_comp_id 5: _pdbx_struct_sheet_hbond.range_1_auth_asym_id 5: _pdbx_struct_sheet_hbond.range_1_auth_seq_id 5: _pdbx_struct_sheet_hbond.range_2_label_atom_id 5: _pdbx_struct_sheet_hbond.range_2_label_comp_id 5: _pdbx_struct_sheet_hbond.range_2_label_asym_id 5: _pdbx_struct_sheet_hbond.range_2_label_seq_id 5: _pdbx_struct_sheet_hbond.range_2_PDB_ins_code 5: _pdbx_struct_sheet_hbond.range_2_auth_atom_id 5: _pdbx_struct_sheet_hbond.range_2_auth_comp_id 5: _pdbx_struct_sheet_hbond.range_2_auth_asym_id 5: _pdbx_struct_sheet_hbond.range_2_auth_seq_id 5: A 1 2 O PHE A 65 ? O PHE A 65 N PHE A 50 ? N PHE A 50 5: A 2 3 N SER A 55 ? N SER A 55 O ALA A 40 ? O ALA A 40 5: A 3 4 N ILE A 43 ? N ILE A 43 O GLY A 5 ? O GLY A 5 5: A 4 5 N GLU A 13 ? N GLU A 13 O THR A 131 ? O THR A 131 5: A 5 6 N TYR A 134 ? N TYR A 134 O LEU A 119 ? O LEU A 119 5: A 6 7 N THR A 124 ? N THR A 124 O SER A 108 ? O SER A 108 5: A 7 8 O ARG A 111 ? O ARG A 111 N MET A 93 ? N MET A 93 5: A 8 9 O LYS A 98 ? O LYS A 98 N LYS A 82 ? N LYS A 82 5: A 9 10 N SER A 83 ? N SER A 83 O PHE A 71 ? O PHE A 71 5: # 5: =============================================================================== 5: test cases: 1 | 1 passed 5: assertions: - none - 5: 7: Will drop category struct_sheet_order since it cannot be repaired 7: Will drop category struct_sheet_hbond since it cannot be repaired 2/9 Test #5: rename-compound-test ............. Passed 0.20 sec test 8 Start 8: validate-pdbx-test 8: Test command: /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test/validate-pdbx-test "--data-dir" "/build/reproducible-path/libcifpp-9.0.5/test" 8: Working Directory: /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test 8: Test timeout computed to be: 1500 4: Randomness seeded to: 3641769157 4: =============================================================================== 4: All tests passed (4 assertions in 1 test case) 4: 3/9 Test #4: query-test ....................... Passed 0.21 sec test 9 Start 9: matrix-test 9: Test command: /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test/matrix-test "--data-dir" "/build/reproducible-path/libcifpp-9.0.5/test" 9: Working Directory: /build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu/test 9: Test timeout computed to be: 1500 9: Randomness seeded to: 2197081650 9: =============================================================================== 9: All tests passed (4 assertions in 4 test cases) 9: 4/9 Test #9: matrix-test ...................... Passed 0.01 sec 7: Will drop category struct_sheet_order since it cannot be repaired 7: Will drop category struct_sheet_hbond since it cannot be repaired 3: Warning: no atoms loaded 3: =============================================================================== 3: All tests passed (13118 assertions in 8 test cases) 3: 5/9 Test #3: model-test ....................... Passed 0.28 sec 7: 7: Configuration error: 7: 7: The attempt to retrieve compound information for "ZQ8" failed. 7: 7: This information is searched for in a CCD file called components.cif or 7: components.cif.gz which should be located in one of the following directories: 7: 7: 7: (Note that you can add a directory to the search paths by setting the 7: LIBCIFPP_DATA_DIR environmental variable) 7: 7: On Linux an optional cron script might have been installed that automatically updates 7: components.cif and mmCIF dictionary files. This script only works when the file 7: libcifpp.conf contains an uncommented line with the text: 7: 7: update=true 7: 7: If you do not have a working cron script, you can manually update the files 7: in /var/cache/libcifpp using the following commands: 7: 7: curl -o /var/cache/libcifpp/components.cif https://files.wwpdb.org/pub/pdb/data/monomers/components.cif 7: curl -o /var/cache/libcifpp/mmcif_pdbx.dic https://mmcif.wwpdb.org/dictionaries/ascii/mmcif_pdbx_v50.dic 7: curl -o /var/cache/libcifpp/mmcif_ma.dic https://mmcif.wwpdb.org/dictionaries/ascii/mmcif_ma.dic 7: 7: The current order of compound factory objects is: 7: 7: CCD components.cif resource 7: CCD components file: "/build/reproducible-path/libcifpp-9.0.5/test/REA.cif" 7: CCD components file: "/build/reproducible-path/libcifpp-9.0.5/test/HEM.cif" 7: CCD components.cif resource 7: 7: The following named resources were loaded: 7: components.cif -> "/build/reproducible-path/libcifpp-9.0.5/test/../rsrc/ccd-subset.cif" 7: mmcif_pdbx.dic -> "/build/reproducible-path/libcifpp-9.0.5/test/../rsrc/mmcif_pdbx.dic" 7: Randomness seeded to: 1293834792 7: "/build/reproducible-path/libcifpp-9.0.5/test/reconstruct/cif2fasta-1cbs_mutate.cif" 7: "/build/reproducible-path/libcifpp-9.0.5/test/reconstruct/cif2fasta-1cbs_mutate_extend.cif" 7: "/build/reproducible-path/libcifpp-9.0.5/test/reconstruct/1cbs-stripped-2.cif" 7: "/build/reproducible-path/libcifpp-9.0.5/test/reconstruct/cif2fasta-1cbs_insert.cif" 7: "/build/reproducible-path/libcifpp-9.0.5/test/reconstruct/phenix.cif" 7: Unknown compound: ZQ8 8: Randomness seeded to: 3144292446 8: Expected record HEADER but found REMARK 001 8: Expected record TITLE but found REMARK 001 8: Expected record COMPND but found REMARK 001 8: Expected record SOURCE but found REMARK 001 8: Expected record KEYWDS but found REMARK 001 8: Expected record EXPDTA but found REMARK 001 8: Expected record AUTHOR but found REMARK 001 8: Loading component MET... done 8: Loading component MET... done 8: Loading component LYS... done 8: Loading component LYS... done 8: Loading component ILE... done 8: Loading component ILE... done 8: Loading component GLU... done 8: Loading component GLU... done 8: Loading component TYR... done 8: Loading component TYR... done 8: Loading component VAL... done 8: Loading component VAL... done 8: Loading component LEU... done 8: Loading component LEU... done 8: Loading component ALA... done 8: Loading component ALA... done 8: Loading component ASP... done 8: Loading component ASP... done 8: Loading component TRP... done 8: Loading component TRP... done 8: Loading component THR... done 8: Loading component THR... done 8: Loading component HIS... done 8: Loading component HIS... done 8: Loading component ARG... done 8: Loading component ARG... done 8: =============================================================================== 8: All tests passed (17 assertions in 3 test cases) 8: 6/9 Test #8: validate-pdbx-test ............... Passed 0.36 sec 7: "/build/reproducible-path/libcifpp-9.0.5/test/reconstruct/1cbs-stripped.cif" 7: =============================================================================== 7: All tests passed (18 assertions in 1 test case) 7: 7/9 Test #7: reconstruction-test .............. Passed 0.54 sec 2: Randomness seeded to: 2931233158 2: (1.70711,1.70711,0) 2: =============================================================================== 2: All tests passed (5101624 assertions in 16 test cases) 2: 8/9 Test #2: unit-3d-test ..................... Passed 1.63 sec 6: Randomness seeded to: 1089850042 6: =============================================================================== 6: All tests passed (10 assertions in 2 test cases) 6: 9/9 Test #6: sugar-test ....................... Passed 2.94 sec 100% tests passed, 0 tests failed out of 9 Total Test time (real) = 2.95 sec make[1]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' rm -fr -- /tmp/dh-xdg-rundir-HKJ3v1co create-stamp debian/debhelper-build-stamp dh_prep -i rm -f -- debian/libcifpp-doc.substvars debian/libcifpp-data.substvars rm -fr -- debian/.debhelper/generated/libcifpp-doc/ debian/libcifpp-doc/ debian/tmp/ debian/.debhelper/generated/libcifpp-data/ debian/libcifpp-data/ dh_installdirs -i install -m0755 -d debian/libcifpp-data/etc/libcifpp/cache-update.d dh_auto_install -i install -m0755 -d /build/reproducible-path/libcifpp-9.0.5/debian/tmp cd obj-x86_64-linux-gnu && make -j6 install DESTDIR=/build/reproducible-path/libcifpp-9.0.5/debian/tmp AM_UPDATE_INFO_DIR=no INSTALL="install --strip-program=true" make[1]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' /usr/bin/cmake -S/build/reproducible-path/libcifpp-9.0.5 -B/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu --check-build-system CMakeFiles/Makefile.cmake 0 make -f CMakeFiles/Makefile2 preinstall make[2]: Entering directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' make[2]: Nothing to be done for 'preinstall'. make[2]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' Install the project... /usr/bin/cmake -P cmake_install.cmake -- Install configuration: "None" -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/lib/x86_64-linux-gnu/libcifpp.so.9.0.5 -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/lib/x86_64-linux-gnu/libcifpp.so.9 -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/lib/x86_64-linux-gnu/libcifpp.so -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/atom_type.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/category.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/compound.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/condition.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/datablock.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/dictionary_parser.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/exports.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/file.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/format.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/forward_decl.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/gzio.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/item.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/iterator.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/matrix.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/model.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/parser.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/pdb.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/point.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/row.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/symmetry.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/text.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/utilities.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/validate.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/pdb/cif2pdb.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/pdb/io.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/pdb/pdb2cif.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/include/cif++/pdb/tls.hpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/lib/cmake/cifpp/cifpp-targets.cmake -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/lib/cmake/cifpp/cifpp-targets-none.cmake -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/libcifpp/mmcif_ddl.dic -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/libcifpp/mmcif_pdbx.dic -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/libcifpp/mmcif_ma.dic -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/lib/cmake/cifpp/cifpp-config.cmake -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/lib/cmake/cifpp/cifpp-config-version.cmake -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/etc/cron.weekly/update-libcifpp-data -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/etc/libcifpp.conf cifpp: A configuration file has been written to /etc/libcifpp.conf, please edit this file to enable automatic updates -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/etc/libcifpp/cache-update.d -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/bitsandpieces.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/basics.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/index.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/search.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/model.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1matrix__matrix__multiplication.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a15ce5665ae421c0a3db9fac68c149836.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1category_1_1key__element__type.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a8c894208d05a89ca79ed66421d241f0f.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_row.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_model.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1quaternion__type.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_pdb_8hpp_1a022f50570f0370ddce514869b65fb6ae.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/enum_namespacecif_1a701ee5c69b8bf4a14c0807d32581e87d.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1gzio_1_1basic__ogzip__streambuf.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1matrix__scalar__multiplication.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1aa6ba3ba2b2b2dcbabee10461e0b8cad3.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_pdb_8hpp_1a3beb1e1704887c34c3ffcf62ba4c93a2.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1row__initializer.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1mm_1_1monomer.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1mm_1_1polymer.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_format.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/variable_namespacecif_1a54a676462364096110c8178e02693802.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_condition.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1aa629e0bd1ddd07f3ffd7bde1bf0bf0fb.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_row.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/typedef_namespacecif_1aaca06426423d3d411d330b53965e1b2d.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_symmetry.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1symop__datablock.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1gzio_1_1basic__istream.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a277d04e4939dd9a5167dc90c21c00266.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_pdb_8hpp_1a0cdfe208e415aa2b34e1277e5de112cb.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1aaede7d3ae547f8c18450a83b6bcc42e2.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1item__validator.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1ab80f7d084a897f8654fecdcbe4c598ba.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1mm_1_1sugar.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1ab91dfb39e9ee43942c5d384f161b97f3.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_model.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1aeb2069c34c7d86acc4418d3740adf5d8.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1point__type.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1matrix__cofactors.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1ab4b982e1dc64e54d408cf8a9a99a2851.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/page_deprecated.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a9a46e6bb8184b5c4b2867e50d4bafd46.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/variable_namespacecif_1ac0cd49271cfb2fd68933871ab34217d6.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1item__value.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_forward_decl.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_pdb_tls.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_item.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1atom__type__traits_1_1SFData.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_gzio.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a17188febf04153361cad42eb042da64a.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/namespace_cif__colour__detail.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_category.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1gzio_1_1basic__ostream.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/variable_namespacecif_1a9ebb6f223c638daee2bc1bf285be72c8.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1link__validator.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1matrix.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1space__group.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_pdb_8hpp_1aa0d4c3ad5c58499e9cf38a4dd42d11d1.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a1425b605f99bf04eeb638f55c0d91566.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/typedef_gzio_8hpp_1a584b8865c9038c4eeba40de7d4a9f1aa.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_pdb_8hpp_1a0d8dcb296d80df362a6d47d62b9e01c9.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a9ef12a84362871f9b37c36d526dcdc87.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a4da118af7b65801fd61c48356e67e4a1.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/define_exports_8hpp_1aab9ff10a498bf7bb72ce703e00c6551c.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_pdb_8hpp_1a2bcb3bdc779f63c96a1eb84e45ff4c20.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1compound__source.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_parser.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1compound__factory.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_iterator.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1iterator__impl_3_01Category_01_4.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_dictionary_parser.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1validator.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1ab97c8f7af37ad32ee1e96218eef8e0e1.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_pdb_8hpp_1a346afa86961c301f1d4fa6486584e7c7.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/namespace_cif__colour.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1progress__bar.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_validate.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a96cecd643b7fedefcee808419ac8db73.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_atom_type.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1aa697ec53ac311721d137e96508fe6268.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a8864838e9763e207066cdbb217920f21.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1ab9c1b63f260c9ccc3740971d6ca755c7.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_datablock.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1gzio_1_1basic__streambuf.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/enum_namespacecif_1aeffd144259eee54425fd70df1a4c119a.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_pdb_8hpp_1aae0b184e743aa515b75da7b3c494b8ee.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_validate.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1symmetric__matrix.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1acde0f42396a36ed1d56f59e8754968b9.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a57a7530364c9dfa84f8607824e6d70e3.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1aae2f02104c912443c2f40b2647803ccb.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_atom_type.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1ab173f10abbd57122dbfd669f30af5509.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a490147eab255051c58bc3d7d16471e17.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_matrix.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_file.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1iterator__proxy.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a04692e2c6a26c3dd823891c93aa68c46.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_compound.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/enum_model_8hpp_1a6085af7e2c3294d3d5520e387757e8dd.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a4c9bbe02598ccb179023f7d9ed18f4e9.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/typedef_gzio_8hpp_1a41d20db90846830c07aa1b4052e4d61f.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a7555a1d6c76bc1cef206fab9a8d67fad.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a9a07496ad027d7f53edeba05b8946d15.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a1bf743b12f5bba28eab81d100fa6be6f.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/enum_namespacecif_1abd4c1fac9978e10628b9317d386d9287.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_pdb_8hpp_1a5f015134e46f13c6ef9eb9ed84b66d1a.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_point.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a8c224d1a874aab66b434422f03ed85d4.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1gzio_1_1basic__igzip__streambuf.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a0f6dd8dc18df398b116c0c2343c2cfee.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1ae338b65793c18872e8bcdfe6a534c83b.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/typedef_namespacecif_1a8dcfa853b7f2c8b6dcc921d0c646ab46.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1ad8a62060b4918e8fcdba571adcde4295.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/variable_namespacecif_1a481dab6db30774c8562d83bb5182cc7b.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1cell.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1ac0f43cdcc8b1ba95aae5fa92f623993d.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1acb24b83a370551b91948baf851bc3ba4.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/typedef_gzio_8hpp_1a878fb88f8eb9b8c5bde4ed2616dca237.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a3f5264d06e1b2326aadfae8b3b114414.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a1cb6fb0735b49d0e7796d223763718e4.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a0cf4d792e3cf8fb29aa18b8c585b1426.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/variable_namespacecif_1a1c4c3a9495336c603c5f3d7f77f4dc64.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1ff__charconv.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1parse__error.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1abce4bb85397326d1c0a079f43048fa18.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a7b0b6dec945a1157aa9d455fd35494df.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/define_exports_8hpp_1a42700069adcc34faeda32076bd173dc1.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a2a94aaedfb605f4e6a403e8790ee4cfd.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1ad57ceedd9a74df6a781247532781c5fa.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1ae025ebbaf906da6b0e66d3fa6657c536.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1mm_1_1residue.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_pdb_tls.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1gzio_1_1basic__ofstream.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1multiple__results__error.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_compound.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/unabridged_orphan.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a4f2dd5c988ef77316bb4fdda57146fd5.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1transformation.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1symmetric__matrix__fixed.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a00df2cb74b5f9590f7f3e4d64ed08077.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1abbc95fb717f14cca92d73ff5ed83c685.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1compound.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/variable_namespacecif_1a4d1e6f19e4404091efa6d14e14654e63.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_pdb_io.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/dir_cif++_pdb.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1atom__type__traits.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1aa0722da1df2e70c4c68cb1e512978cae.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/variable_gzio_8hpp_1a1cc3c9e961807f24cc997b0fdfbe76a6.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1ab5bf28cddf2fe7bbfe60778c60f9082e.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/enum_namespacecif_1a22f8e0bb538e176ebddfe89c7ef03a6d.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_pdb_io.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a643804a021f65a34aa75f121f3023104.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a470ad3905a4aa5fe52da998640740ab7.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/enum_namespacecif_1a9579bd6dc036aa07dcb73e9724cd4f54.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_pdb_8hpp_1a965679d61a80ce38487bb63eb1759281.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a02741e5ba23265cacfda366089d13f00.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a0e173ffb184bab07d483866b6f2f7274.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_symmetry_8hpp_1a5a53cac9d72c839c804fd7619f764d67.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a75df878566a514b909141bad937280f4.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/typedef_namespacecif_1a5ae3b948c3296e47bf3ae734cfdca029.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/define_utilities_8hpp_1ae2fe1725bb5e9823d089c46b9ed5266e.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/define_utilities_8hpp_1abd165ee6474b5b75bf075842fff13a04.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_text.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_condition_8hpp_1ae3fb5e492867225091edeba773f91d39.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/variable_namespacecif_1a6dacacf91cee6e2c246a2334f0fbd607.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_pdb.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/namespace_cif__detail.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a2b6f06460cea1b44770b316c8c5d4b06.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a8f9736ac0d35666ef1a68f02705b8507.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1ac3d9a984c107208b0abbabe5f9e05289.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1spacegroup.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a016b23e15d2a1d5f8121a697d7bec68e.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_pdb_8hpp_1a631597613cf60653370f704184d3b9d7.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a52c1d908e7a659686a16cbde3684f7a1.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_pdb_8hpp_1ac681cb3a6237bc71dcba0e88fb1c0832.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/enum_namespacecif_1ae5e65dddeeceb84cd55b772eaca216c7.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1key.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a0987fe676d4bf9554de808bfe9b13a6b.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_item.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a3fa150213a7a95d9d013b5faeae2d5f2.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/enum_model_8hpp_1a84341c70c74ab432b534a3bac3034dbb.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/enum_utilities_8hpp_1a8fd997c36131df71885f44abf2297523.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1mm_1_1structure.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_symmetry.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_category.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a9de541062d328307198b32e4680ac29b.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/variable_namespacecif_1a9347107ebb4ef72dca122c3285453c4f.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1matrix__subtraction.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a23c62f901e53b06d736b955cbb079336.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a674345a2d0fb9af13bea9c833076cec0.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/typedef_namespacecif_1ae5965db5577f7f70118a5d976232d966.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a89f948a7392e875f87012ca961060cb3.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1iless.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1matrix__expression.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_model_8hpp_1ab82fb33002132ca78f0f0de0855a9883.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/variable_namespacecif_1a1c875e7bda01246ff90860b7228b89b9.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_pdb_8hpp_1affa360f702ea4f0811f02b87211294c0.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a5a94d01c3d87fb157ae322b347129e56.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a31bf31f1feff330b402ab96d51b4f458.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/enum_namespacecif_1a339253d4b856d267db110e2e55b6fa46.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1validation__exception.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1fill__out__streambuf.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1iterator__impl.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a337647d2ca82951e159b244e0a892f0e.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/variable_namespacecif_1aee0d4f8adeaf464b4201156efbb97f73.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1crystal.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1compound__bond.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1ac29c380eff41208bca6fce85b26cbb0b.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_file.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1datablock.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1iterator__impl_3_01Category_00_01T_01_4.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/namespace_cif__gzio.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1row__handle.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a28d3d6db55465d265cb5b6a7a7d93a6b.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a449c5d43d72a9779d3338c2882d13e36.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_forward_decl.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1item__handle.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a2db5caf5ac5cd4376f29255fa9eebbc0.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1empty__type.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a10ff1c475902516ebcd1cf4059ac513b.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1identity__matrix.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1ac0219abe114a15fecf35b9305c6a51b9.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_utilities.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1af443771f125de0bdc78726a4235fc1a3.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/enum_utilities_8hpp_1a2dfb81ba6ea862bc2483f1fed3477dcf.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1afdee9d0ba328b6dc1219e83b128b003b.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1category__validator.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_pdb_8hpp_1aa57fd6d1c296ee70c9784fc59382d7c1.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/namespace_cif__literals.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_pdb_8hpp_1a0ca52e86fd5c866cb07ee1d2bd6e0be6.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a444f4493c315230d1137f13d0e28920c.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_text.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1gzio_1_1basic__ifstream.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1condition.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1ad6daf4b6c782edbfeb0236e71f9e6ae1.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1sym__op.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1parser.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a4c27e27d4cb70a2e13cf2efb05ccd325.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_model_8hpp_1a9bb5822efb054c2979a666d9bfc0913d.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_pdb_8hpp_1a429736e305a06f11b86700d76f8b1ac3.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1file.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_condition.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1item__alias.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1matrix__fixed.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1ad0c5beb6c8ad7621c2ec415432b33c48.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1symop__data.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/variable_namespacecif_1a335e9db77e4d400afe98317a0da325f9.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/namespace_cif__mm.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a26cac7b3c044dff1bdcac52425e775f9.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1adecaf77ddb0b38da346fecf70b5df2e0.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_utilities.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1mm_1_1structure__open__options.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/typedef_namespacecif_1a2551a5f548db36f37a54c902a7159580.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a39ae1da888a5c8a6ee7f1438b78b7734.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a2996a300e6f91f05abb11706b3c3cef2.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1item.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_pdb_cif2pdb.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/enum_namespacecif_1a636b6271c6af17a0d73dbe4557061c03.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_parser.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_matrix.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_point.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/typedef_namespacecif_1a88b677fc53a3f1e8e0f15cdb6dc52cb7.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_pdb.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/typedef_namespacecif_1a0d929afa021a00eaa3819005173553b4.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a27048ca516d6ab9d61b330b3ae27b37f.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/define_exports_8hpp_1a34c1ecdfe0e74030d387cc4e3db0f20d.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1mm_1_1atom.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_exports.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_pdb_cif2pdb.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_pdb_pdb2cif.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/namespace_cif.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1aee7c4c79e259a8c70f8534f1ce3e39a5.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1sub__matrix.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/namespace_cif__pdb.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a1020ee51b50043210b5e9c8eaecd4c28.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a18461202bb0b0d4d134bc3eb46455776.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a07568e2424a8b9f3d87c0e7b506f01c8.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1ae8f1330ded658c851bda5859f2e071bc.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_pdb_pdb2cif.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a302fdd5a6fea6ea6a874f4e635bd43e3.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a867dc9c21324a3e65a931bb4d7160a9e.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a9dbdac69f3a21d391ece6cc214da3075.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1atom__type__info.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1ad3654e07e2f3102ac503499fa51d930f.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a2e9af2d268ca7932d3b5df430dfabfe7.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/define_exports_8hpp_1af93831e3c71f1f7a80712cd6b3812992.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1mm_1_1branch.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a7da448991e41eef2fa6dbf113827f958.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1type__validator.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a5c256bdffd9190e69c087e64b69d786d.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1acc0e956a0d6382e85c6ecb631e2edd21.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1colour_1_1detail_1_1coloured__string__t.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a65ac1856b4a8a6675e6a0f0d9b5edfaa.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a2190ac2315339dabb5be80f2a8634e29.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_exports.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/library_root.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a8c495f22c9ff90161b1ae539552e02aa.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_model_8hpp_1aaaea875b497445410924763ba322f0f4.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_pdb_8hpp_1a8442a8beb3ec3862b1223091ba279b3f.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1row.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1category_1_1link.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a561da00d019d125f7356b8717771b6b6.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a86caa43dc2def46857ab3eb037b63f2b.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_pdb_8hpp_1aa1addf5082e01849dc7b0af93aa0d34d.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1duplicate__key__error.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a2bce0a62772ef8e6c5128b36d4cbb9ce.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_iterator.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/file_cif++_datablock.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1conditional__iterator__proxy.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1validator__factory.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/typedef_namespacecif_1a35974aa02359ef095b68335a05849c53.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a07b180b747ac558694dfb1e73503dc71.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1spherical__dots.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_gzio.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1a94db0d39a3d82bde5ae35a2d5a729dce.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/dir_cif++.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1validation__category__impl.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_dictionary_parser.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/typedef_namespacecif_1a74bfe90596358d194adfab0eb0054b79.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/variable_namespacecif_1a2ac4506e2b83a34ec6cc15a024f9b677.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1aeb28b4b173153589179f4f7b5d20c063.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1compound__atom.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1missing__key__error.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1sac__parser.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/program_listing_file_cif++_format.hpp.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1af6e09fd9a34540b7718e7f76a0029629.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/classcif_1_1category.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/function_namespacecif_1ac4c468df4c799fd242842a86e523bc3e.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/api/structcif_1_1category_1_1item__entry.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/compound.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/genindex.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/symmetry.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/pygments.css -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/sphinx_highlight.js -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/fonts -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/fonts/Lato-BoldItalic.ttf -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/fonts/fontawesome-webfont.woff2 -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/fonts/Lato-Regular.ttf -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/fonts/RobotoSlab-Regular.woff2 -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/fonts/fontawesome-webfont.ttf -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/fonts/Lato-Bold.woff2 -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/fonts/RobotoSlab-Bold.woff2 -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/fonts/fontawesome-webfont.svg -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/fonts/fontawesome-webfont.woff -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/fonts/fontawesome-webfont.eot -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/fonts/Lato-Regular.woff2 -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/fonts/Lato-Italic.ttf -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/fonts/Lato-BoldItalic.woff2 -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/fonts/Lato-Italic.woff2 -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/fonts/Lato-Bold.ttf -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/file.png -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/minus.png -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/_sphinx_javascript_frameworks_compat.js -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/basic.css -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/css -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/css/badge_only.css -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/css/theme.css -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/searchtools.js -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/documentation_options.js -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/plus.png -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/js -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/js/theme.js -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/js/versions.js -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/jquery.js -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/language_data.js -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_static/doctools.js -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/objects.inv -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/resources.html -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/compound.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/index.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/resources.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a4c9bbe02598ccb179023f7d9ed18f4e9.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/define_exports_8hpp_1a34c1ecdfe0e74030d387cc4e3db0f20d.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1iless.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ad57ceedd9a74df6a781247532781c5fa.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a8f9736ac0d35666ef1a68f02705b8507.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_pdb_pdb2cif.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1abce4bb85397326d1c0a079f43048fa18.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/typedef_namespacecif_1aaca06426423d3d411d330b53965e1b2d.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_category.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/enum_namespacecif_1a9579bd6dc036aa07dcb73e9724cd4f54.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1sym__op.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1gzio_1_1basic__streambuf.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1mm_1_1structure.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a0cdfe208e415aa2b34e1277e5de112cb.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1condition.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a26cac7b3c044dff1bdcac52425e775f9.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a23c62f901e53b06d736b955cbb079336.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1colour_1_1detail_1_1coloured__string__t.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a10ff1c475902516ebcd1cf4059ac513b.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a96cecd643b7fedefcee808419ac8db73.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a7da448991e41eef2fa6dbf113827f958.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_iterator.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1aaede7d3ae547f8c18450a83b6bcc42e2.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/page_deprecated.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1a6dacacf91cee6e2c246a2334f0fbd607.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ab173f10abbd57122dbfd669f30af5509.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a07b180b747ac558694dfb1e73503dc71.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1acde0f42396a36ed1d56f59e8754968b9.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a0ca52e86fd5c866cb07ee1d2bd6e0be6.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1aeb2069c34c7d86acc4418d3740adf5d8.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a0e173ffb184bab07d483866b6f2f7274.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1afdee9d0ba328b6dc1219e83b128b003b.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a867dc9c21324a3e65a931bb4d7160a9e.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/typedef_namespacecif_1a5ae3b948c3296e47bf3ae734cfdca029.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1validator.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_parser.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a86caa43dc2def46857ab3eb037b63f2b.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_item.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/enum_namespacecif_1a636b6271c6af17a0d73dbe4557061c03.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a07568e2424a8b9f3d87c0e7b506f01c8.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/namespace_cif__mm.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_model_8hpp_1aaaea875b497445410924763ba322f0f4.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/library_root.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/typedef_namespacecif_1a35974aa02359ef095b68335a05849c53.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1ac0cd49271cfb2fd68933871ab34217d6.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1acc0e956a0d6382e85c6ecb631e2edd21.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1gzio_1_1basic__ostream.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_text.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1abbc95fb717f14cca92d73ff5ed83c685.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/enum_model_8hpp_1a84341c70c74ab432b534a3bac3034dbb.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_pdb.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1iterator__impl_3_01Category_00_01T_01_4.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1ff__charconv.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/typedef_namespacecif_1a8dcfa853b7f2c8b6dcc921d0c646ab46.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1atom__type__traits_1_1SFData.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a02741e5ba23265cacfda366089d13f00.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/variable_gzio_8hpp_1a1cc3c9e961807f24cc997b0fdfbe76a6.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a1bf743b12f5bba28eab81d100fa6be6f.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a022f50570f0370ddce514869b65fb6ae.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1aa697ec53ac311721d137e96508fe6268.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a5a94d01c3d87fb157ae322b347129e56.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ac0219abe114a15fecf35b9305c6a51b9.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1a481dab6db30774c8562d83bb5182cc7b.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a94db0d39a3d82bde5ae35a2d5a729dce.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1a54a676462364096110c8178e02693802.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a04692e2c6a26c3dd823891c93aa68c46.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a8c495f22c9ff90161b1ae539552e02aa.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1validator__factory.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a9ef12a84362871f9b37c36d526dcdc87.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1key.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a18461202bb0b0d4d134bc3eb46455776.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a2a94aaedfb605f4e6a403e8790ee4cfd.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1row__handle.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1mm_1_1branch.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1symop__datablock.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_matrix.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a1cb6fb0735b49d0e7796d223763718e4.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a17188febf04153361cad42eb042da64a.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1duplicate__key__error.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1symmetric__matrix__fixed.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1matrix__expression.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1acb24b83a370551b91948baf851bc3ba4.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1mm_1_1atom.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1atom__type__traits.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1parser.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_symmetry_8hpp_1a5a53cac9d72c839c804fd7619f764d67.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/typedef_namespacecif_1a88b677fc53a3f1e8e0f15cdb6dc52cb7.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1gzio_1_1basic__igzip__streambuf.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a3beb1e1704887c34c3ffcf62ba4c93a2.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_pdb_tls.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a2996a300e6f91f05abb11706b3c3cef2.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1compound__factory.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/dir_cif++.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1gzio_1_1basic__istream.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_pdb_io.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ab80f7d084a897f8654fecdcbe4c598ba.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1mm_1_1polymer.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/namespace_cif__colour__detail.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a0cf4d792e3cf8fb29aa18b8c585b1426.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a27048ca516d6ab9d61b330b3ae27b37f.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/typedef_namespacecif_1a0d929afa021a00eaa3819005173553b4.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1category_1_1key__element__type.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a3f5264d06e1b2326aadfae8b3b114414.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1aa0d4c3ad5c58499e9cf38a4dd42d11d1.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1ac681cb3a6237bc71dcba0e88fb1c0832.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ae338b65793c18872e8bcdfe6a534c83b.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1af6e09fd9a34540b7718e7f76a0029629.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_validate.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_file.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1space__group.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ae025ebbaf906da6b0e66d3fa6657c536.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_text.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/namespace_cif__colour.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a0f6dd8dc18df398b116c0c2343c2cfee.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/define_exports_8hpp_1af93831e3c71f1f7a80712cd6b3812992.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_file.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/namespace_cif__detail.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_model_8hpp_1ab82fb33002132ca78f0f0de0855a9883.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a9dbdac69f3a21d391ece6cc214da3075.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/typedef_gzio_8hpp_1a41d20db90846830c07aa1b4052e4d61f.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a470ad3905a4aa5fe52da998640740ab7.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a277d04e4939dd9a5167dc90c21c00266.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1aa1addf5082e01849dc7b0af93aa0d34d.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1mm_1_1residue.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1matrix__fixed.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a9de541062d328307198b32e4680ac29b.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1category_1_1item__entry.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a346afa86961c301f1d4fa6486584e7c7.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1datablock.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a1020ee51b50043210b5e9c8eaecd4c28.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a449c5d43d72a9779d3338c2882d13e36.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1matrix.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1conditional__iterator__proxy.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1compound__atom.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_point.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1affa360f702ea4f0811f02b87211294c0.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1a9ebb6f223c638daee2bc1bf285be72c8.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_forward_decl.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1a2ac4506e2b83a34ec6cc15a024f9b677.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a643804a021f65a34aa75f121f3023104.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_model.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a2190ac2315339dabb5be80f2a8634e29.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/enum_utilities_8hpp_1a8fd997c36131df71885f44abf2297523.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1compound__bond.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1link__validator.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1iterator__impl.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/enum_namespacecif_1a22f8e0bb538e176ebddfe89c7ef03a6d.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1symop__data.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_pdb_io.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ac0f43cdcc8b1ba95aae5fa92f623993d.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a2bcb3bdc779f63c96a1eb84e45ff4c20.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_compound.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_pdb.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1matrix__cofactors.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a5f015134e46f13c6ef9eb9ed84b66d1a.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1aa6ba3ba2b2b2dcbabee10461e0b8cad3.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a9a46e6bb8184b5c4b2867e50d4bafd46.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/namespace_cif__gzio.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1a335e9db77e4d400afe98317a0da325f9.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_gzio.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a00df2cb74b5f9590f7f3e4d64ed08077.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a490147eab255051c58bc3d7d16471e17.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_exports.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1cell.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1spacegroup.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/define_exports_8hpp_1a42700069adcc34faeda32076bd173dc1.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a429736e305a06f11b86700d76f8b1ac3.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1mm_1_1monomer.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1fill__out__streambuf.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_pdb_tls.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1identity__matrix.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1aae2f02104c912443c2f40b2647803ccb.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1row.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_format.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_matrix.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/enum_namespacecif_1abd4c1fac9978e10628b9317d386d9287.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1atom__type__info.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/define_exports_8hpp_1aab9ff10a498bf7bb72ce703e00c6551c.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a2bce0a62772ef8e6c5128b36d4cbb9ce.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1aa0722da1df2e70c4c68cb1e512978cae.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a7b0b6dec945a1157aa9d455fd35494df.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1category__validator.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_item.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1mm_1_1sugar.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/define_utilities_8hpp_1abd165ee6474b5b75bf075842fff13a04.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_atom_type.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a15ce5665ae421c0a3db9fac68c149836.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a1425b605f99bf04eeb638f55c0d91566.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1validation__exception.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1af443771f125de0bdc78726a4235fc1a3.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_validate.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/unabridged_orphan.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_datablock.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_row.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/enum_utilities_8hpp_1a2dfb81ba6ea862bc2483f1fed3477dcf.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1a4d1e6f19e4404091efa6d14e14654e63.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_model.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/typedef_namespacecif_1a74bfe90596358d194adfab0eb0054b79.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a75df878566a514b909141bad937280f4.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_compound.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/enum_namespacecif_1ae5e65dddeeceb84cd55b772eaca216c7.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a561da00d019d125f7356b8717771b6b6.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1mm_1_1structure__open__options.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a39ae1da888a5c8a6ee7f1438b78b7734.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ab97c8f7af37ad32ee1e96218eef8e0e1.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a31bf31f1feff330b402ab96d51b4f458.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a3fa150213a7a95d9d013b5faeae2d5f2.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a2e9af2d268ca7932d3b5df430dfabfe7.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1item__handle.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a5c256bdffd9190e69c087e64b69d786d.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1sac__parser.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1progress__bar.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_point.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1matrix__scalar__multiplication.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1a9347107ebb4ef72dca122c3285453c4f.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/enum_namespacecif_1a339253d4b856d267db110e2e55b6fa46.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1category_1_1link.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1aeb28b4b173153589179f4f7b5d20c063.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1point__type.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1matrix__matrix__multiplication.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ab4b982e1dc64e54d408cf8a9a99a2851.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1missing__key__error.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1crystal.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ab9c1b63f260c9ccc3740971d6ca755c7.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_atom_type.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_utilities.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_parser.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a016b23e15d2a1d5f8121a697d7bec68e.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a631597613cf60653370f704184d3b9d7.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ac4c468df4c799fd242842a86e523bc3e.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1gzio_1_1basic__ogzip__streambuf.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1empty__type.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1spherical__dots.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ab91dfb39e9ee43942c5d384f161b97f3.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1transformation.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1multiple__results__error.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ad3654e07e2f3102ac503499fa51d930f.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a2db5caf5ac5cd4376f29255fa9eebbc0.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/typedef_gzio_8hpp_1a878fb88f8eb9b8c5bde4ed2616dca237.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a4da118af7b65801fd61c48356e67e4a1.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_format.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a9a07496ad027d7f53edeba05b8946d15.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/enum_model_8hpp_1a6085af7e2c3294d3d5520e387757e8dd.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1file.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_symmetry.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/typedef_gzio_8hpp_1a584b8865c9038c4eeba40de7d4a9f1aa.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1sub__matrix.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/typedef_namespacecif_1ae5965db5577f7f70118a5d976232d966.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_iterator.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1iterator__impl_3_01Category_01_4.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1compound__source.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/namespace_cif__pdb.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ac29c380eff41208bca6fce85b26cbb0b.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1gzio_1_1basic__ofstream.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1aee7c4c79e259a8c70f8534f1ce3e39a5.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a8c894208d05a89ca79ed66421d241f0f.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1item__validator.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a337647d2ca82951e159b244e0a892f0e.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a89f948a7392e875f87012ca961060cb3.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/namespace_cif__literals.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a28d3d6db55465d265cb5b6a7a7d93a6b.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_pdb_cif2pdb.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1aa57fd6d1c296ee70c9784fc59382d7c1.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_exports.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a57a7530364c9dfa84f8607824e6d70e3.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1item.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_condition.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a0987fe676d4bf9554de808bfe9b13a6b.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1adecaf77ddb0b38da346fecf70b5df2e0.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ae8f1330ded658c851bda5859f2e071bc.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ad0c5beb6c8ad7621c2ec415432b33c48.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a65ac1856b4a8a6675e6a0f0d9b5edfaa.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_gzio.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_datablock.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1type__validator.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1symmetric__matrix.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a8864838e9763e207066cdbb217920f21.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_pdb_pdb2cif.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_pdb_cif2pdb.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/namespace_cif.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a2b6f06460cea1b44770b316c8c5d4b06.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1gzio_1_1basic__ifstream.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ab5bf28cddf2fe7bbfe60778c60f9082e.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a444f4493c315230d1137f13d0e28920c.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1validation__category__impl.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_condition_8hpp_1ae3fb5e492867225091edeba773f91d39.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a7555a1d6c76bc1cef206fab9a8d67fad.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ac3d9a984c107208b0abbabe5f9e05289.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1category.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a4f2dd5c988ef77316bb4fdda57146fd5.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_symmetry.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_row.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ad8a62060b4918e8fcdba571adcde4295.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a8c224d1a874aab66b434422f03ed85d4.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1aa629e0bd1ddd07f3ffd7bde1bf0bf0fb.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_model_8hpp_1a9bb5822efb054c2979a666d9bfc0913d.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a8442a8beb3ec3862b1223091ba279b3f.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1item__alias.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1iterator__proxy.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_utilities.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ad6daf4b6c782edbfeb0236e71f9e6ae1.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_dictionary_parser.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/enum_namespacecif_1aeffd144259eee54425fd70df1a4c119a.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a674345a2d0fb9af13bea9c833076cec0.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1compound.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1row__initializer.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1matrix__subtraction.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_category.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a965679d61a80ce38487bb63eb1759281.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1a1c4c3a9495336c603c5f3d7f77f4dc64.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/structcif_1_1item__value.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/typedef_namespacecif_1a2551a5f548db36f37a54c902a7159580.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a302fdd5a6fea6ea6a874f4e635bd43e3.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_condition.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1aae0b184e743aa515b75da7b3c494b8ee.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a4c27e27d4cb70a2e13cf2efb05ccd325.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/define_utilities_8hpp_1ae2fe1725bb5e9823d089c46b9ed5266e.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_dictionary_parser.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/dir_cif++_pdb.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a0d8dcb296d80df362a6d47d62b9e01c9.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/file_cif++_forward_decl.hpp.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1parse__error.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a52c1d908e7a659686a16cbde3684f7a1.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1a1c875e7bda01246ff90860b7228b89b9.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1aee0d4f8adeaf464b4201156efbb97f73.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/classcif_1_1quaternion__type.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/api/enum_namespacecif_1a701ee5c69b8bf4a14c0807d32581e87d.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/symmetry.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/bitsandpieces.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/basics.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/genindex.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/_sources/model.rst.txt -- Installing: /build/reproducible-path/libcifpp-9.0.5/debian/tmp/usr/share/doc/libcifpp/searchindex.js make[1]: Leaving directory '/build/reproducible-path/libcifpp-9.0.5/obj-x86_64-linux-gnu' dh_install -i install -m0755 -d debian/libcifpp-doc//usr/share/doc/libcifpp cp --reflink=auto -a debian/tmp/usr/share/doc/libcifpp/_sources debian/tmp/usr/share/doc/libcifpp/_static debian/tmp/usr/share/doc/libcifpp/api debian/tmp/usr/share/doc/libcifpp/basics.html debian/tmp/usr/share/doc/libcifpp/bitsandpieces.html debian/tmp/usr/share/doc/libcifpp/compound.html debian/tmp/usr/share/doc/libcifpp/genindex.html debian/tmp/usr/share/doc/libcifpp/index.html debian/tmp/usr/share/doc/libcifpp/model.html debian/tmp/usr/share/doc/libcifpp/objects.inv debian/tmp/usr/share/doc/libcifpp/resources.html debian/tmp/usr/share/doc/libcifpp/search.html debian/tmp/usr/share/doc/libcifpp/searchindex.js debian/tmp/usr/share/doc/libcifpp/symmetry.html debian/libcifpp-doc//usr/share/doc/libcifpp/ install -m0755 -d debian/libcifpp-data//etc/cron.weekly cp --reflink=auto -a debian/tmp/etc/cron.weekly/update-libcifpp-data debian/libcifpp-data//etc/cron.weekly/ install -m0755 -d debian/libcifpp-data//usr/share/libcifpp cp --reflink=auto -a debian/tmp/usr/share/libcifpp/mmcif_ddl.dic debian/tmp/usr/share/libcifpp/mmcif_ma.dic debian/tmp/usr/share/libcifpp/mmcif_pdbx.dic debian/libcifpp-data//usr/share/libcifpp/ dh_installdocs -i install -m0755 -d debian/libcifpp-doc/usr/share/doc/libcifpp-doc install -p -m0644 debian/copyright debian/libcifpp-doc/usr/share/doc/libcifpp-doc/copyright install -m0755 -d debian/libcifpp-doc/usr/share/doc-base/ install -p -m0644 debian/libcifpp-doc.doc-base debian/libcifpp-doc/usr/share/doc-base/libcifpp-doc.libcifpp-doc install -m0755 -d debian/libcifpp-data/usr/share/doc/libcifpp-data install -p -m0644 debian/copyright debian/libcifpp-data/usr/share/doc/libcifpp-data/copyright dh_installchangelogs -i install -m0755 -d debian/libcifpp-data/usr/share/doc/libcifpp-data install -p -m0644 debian/.debhelper/generated/libcifpp-data/dh_installchangelogs.dch.trimmed debian/libcifpp-data/usr/share/doc/libcifpp-data/changelog.Debian install -p -m0644 ./changelog debian/libcifpp-data/usr/share/doc/libcifpp-data/changelog install -m0755 -d debian/libcifpp-doc/usr/share/doc/libcifpp-doc install -p -m0644 debian/.debhelper/generated/libcifpp-doc/dh_installchangelogs.dch.trimmed debian/libcifpp-doc/usr/share/doc/libcifpp-doc/changelog.Debian install -p -m0644 ./changelog debian/libcifpp-doc/usr/share/doc/libcifpp-doc/changelog dh_installexamples -i dh_installdebconf -i install -m0755 -d debian/libcifpp-doc/DEBIAN install -m0755 -d debian/libcifpp-data/DEBIAN cp -f debian/libcifpp-data.config debian/libcifpp-data/DEBIAN/config [META] Replace #TOKEN#s in "debian/libcifpp-data/DEBIAN/config" chmod 0755 -- debian/libcifpp-data/DEBIAN/config po2debconf debian/libcifpp-data.templates > debian/libcifpp-data/DEBIAN/templates mv debian/libcifpp-data.substvars.new debian/libcifpp-data.substvars [META] Append autosnippet "postrm-debconf" to postrm [debian/libcifpp-data.postrm.debhelper] dh_perl -i dh_link -i dh_strip_nondeterminism -i Using 1763627154 as canonical time Normalizing debian/libcifpp-doc/usr/share/doc/libcifpp/_static/file.png using File::StripNondeterminism::handlers::png Normalizing debian/libcifpp-doc/usr/share/doc/libcifpp/_static/minus.png using File::StripNondeterminism::handlers::png Normalizing debian/libcifpp-doc/usr/share/doc/libcifpp/_static/plus.png using File::StripNondeterminism::handlers::png dh_compress -i cd debian/libcifpp-doc cd debian/libcifpp-data chmod a-x usr/share/doc/libcifpp-data/changelog usr/share/doc/libcifpp-data/changelog.Debian gzip -9nf usr/share/doc/libcifpp-data/changelog usr/share/doc/libcifpp-data/changelog.Debian chmod a-x usr/share/doc/libcifpp-doc/changelog usr/share/doc/libcifpp-doc/changelog.Debian usr/share/doc/libcifpp/_static/fonts/Lato-Bold.ttf usr/share/doc/libcifpp/_static/fonts/Lato-BoldItalic.ttf usr/share/doc/libcifpp/_static/fonts/Lato-Italic.ttf usr/share/doc/libcifpp/_static/fonts/Lato-Regular.ttf usr/share/doc/libcifpp/_static/fonts/fontawesome-webfont.eot usr/share/doc/libcifpp/_static/fonts/fontawesome-webfont.ttf cd '/build/reproducible-path/libcifpp-9.0.5' gzip -9nf usr/share/doc/libcifpp-doc/changelog usr/share/doc/libcifpp-doc/changelog.Debian usr/share/doc/libcifpp/_static/fonts/Lato-Bold.ttf usr/share/doc/libcifpp/_static/fonts/Lato-BoldItalic.ttf usr/share/doc/libcifpp/_static/fonts/Lato-Italic.ttf usr/share/doc/libcifpp/_static/fonts/Lato-Regular.ttf usr/share/doc/libcifpp/_static/fonts/fontawesome-webfont.eot usr/share/doc/libcifpp/_static/fonts/fontawesome-webfont.ttf cd '/build/reproducible-path/libcifpp-9.0.5' dh_fixperms -i find debian/libcifpp-doc ! -type l -a -true -a -true -print0 2>/dev/null | xargs -0r chmod go=rX,u+rw,a-s find debian/libcifpp-data ! -type l -a -true -a -true -print0 2>/dev/null | xargs -0r chmod go=rX,u+rw,a-s find debian/libcifpp-data/usr/share/doc -type f -a -true -a ! -regex 'debian/libcifpp-data/usr/share/doc/[^/]*/examples/.*' -print0 2>/dev/null | xargs -0r chmod 0644 find debian/libcifpp-data/usr/share/doc -type d -a -true -a -true -print0 2>/dev/null | xargs -0r chmod 0755 find debian/libcifpp-doc/usr/share/doc -type f -a -true -a ! -regex 'debian/libcifpp-doc/usr/share/doc/[^/]*/examples/.*' -print0 2>/dev/null | xargs -0r chmod 0644 find debian/libcifpp-data -type f \( -name '*.so.*' -o -name '*.so' -o -name '*.la' -o -name '*.a' -o -name '*.js' -o -name '*.css' -o -name '*.scss' -o -name '*.sass' -o -name '*.jpeg' -o -name '*.jpg' -o -name '*.png' -o -name '*.gif' -o -name '*.cmxs' -o -name '*.node' \) -a -true -a -true -print0 2>/dev/null | xargs -0r chmod 0644 find debian/libcifpp-doc/usr/share/doc -type d -a -true -a -true -print0 2>/dev/null | xargs -0r chmod 0755 find debian/libcifpp-doc -type f \( -name '*.so.*' -o -name '*.so' -o -name '*.la' -o -name '*.a' -o -name '*.js' -o -name '*.css' -o -name '*.scss' -o -name '*.sass' -o -name '*.jpeg' -o -name '*.jpg' -o -name '*.png' -o -name '*.gif' -o -name '*.cmxs' -o -name '*.node' \) -a -true -a -true -print0 2>/dev/null | xargs -0r chmod 0644 dh_missing -i dh_installdeb -i install -m0755 -d debian/libcifpp-doc/DEBIAN install -m0755 -d debian/libcifpp-data/DEBIAN cp -f debian/libcifpp-data.postinst debian/libcifpp-data/DEBIAN/postinst [META] Replace #TOKEN#s in "debian/libcifpp-data/DEBIAN/postinst" chmod 0755 -- debian/libcifpp-data/DEBIAN/postinst cp -f debian/libcifpp-data.postrm debian/libcifpp-data/DEBIAN/postrm [META] Replace #TOKEN#s in "debian/libcifpp-data/DEBIAN/postrm" chmod 0755 -- debian/libcifpp-data/DEBIAN/postrm find debian/libcifpp-data/etc -type f -printf '/etc/%P ' | LC_ALL=C sort >> debian/libcifpp-data/DEBIAN/conffiles chmod 0644 -- debian/libcifpp-data/DEBIAN/conffiles dh_gencontrol -i install -m0755 -d debian/libcifpp-data/DEBIAN echo misc:Pre-Depends= >> debian/libcifpp-data.substvars dpkg-gencontrol -plibcifpp-data -ldebian/changelog -Tdebian/libcifpp-data.substvars -cdebian/control -Pdebian/libcifpp-data install -m0755 -d debian/libcifpp-doc/DEBIAN echo misc:Depends= >> debian/libcifpp-doc.substvars echo misc:Pre-Depends= >> debian/libcifpp-doc.substvars dpkg-gencontrol -plibcifpp-doc -ldebian/changelog -Tdebian/libcifpp-doc.substvars -cdebian/control -Pdebian/libcifpp-doc chmod 0644 -- debian/libcifpp-data/DEBIAN/control chmod 0644 -- debian/libcifpp-doc/DEBIAN/control dh_md5sums -i install -m0755 -d debian/libcifpp-doc/DEBIAN install -m0755 -d debian/libcifpp-data/DEBIAN cd debian/libcifpp-data >/dev/null && xargs -r0 md5sum | perl -pe 'if (s@^\\@@) { s/\\\\/\\/g; }' > DEBIAN/md5sums cd debian/libcifpp-doc >/dev/null && xargs -r0 md5sum | perl -pe 'if (s@^\\@@) { s/\\\\/\\/g; }' > DEBIAN/md5sums chmod 0644 -- debian/libcifpp-data/DEBIAN/md5sums chmod 0644 -- debian/libcifpp-doc/DEBIAN/md5sums dh_builddeb -i dpkg-deb --root-owner-group --build debian/libcifpp-doc .. dpkg-deb --root-owner-group --build debian/libcifpp-data .. dpkg-deb: building package 'libcifpp-doc' in '../libcifpp-doc_9.0.5-1_all.deb'. dpkg-deb: building package 'libcifpp-data' in '../libcifpp-data_9.0.5-1_all.deb'. dpkg-genbuildinfo --build=all -O../libcifpp_9.0.5-1_all.buildinfo dpkg-genchanges --build=all -O../libcifpp_9.0.5-1_all.changes dpkg-genchanges: info: binary-only arch-indep upload (source code and arch-specific packages not included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) -------------------------------------------------------------------------------- Build finished at 2025-11-21T16:39:41Z Finished -------- I: Built successfully +------------------------------------------------------------------------------+ | Changes Fri, 21 Nov 2025 16:39:42 +0000 | +------------------------------------------------------------------------------+ libcifpp_9.0.5-1_all.changes: ----------------------------- Format: 1.8 Date: Thu, 20 Nov 2025 09:25:54 +0100 Source: libcifpp Binary: libcifpp-data libcifpp-doc Architecture: all Version: 9.0.5-1 Distribution: unstable Urgency: medium Maintainer: Debian Med Packaging Team Changed-By: Maarten L. Hekkelman Description: libcifpp-data - Data files for libcifpp libcifpp-doc - Development files for libcifpp Changes: libcifpp (9.0.5-1) unstable; urgency=medium . * New upstream version 9.0.5 Checksums-Sha1: cf7189784ff11d90b711fb1c6b1e9ebc069528e4 488324 libcifpp-data_9.0.5-1_all.deb 46b2efefa307b71aba733ea0e5865cea0e111eda 3357560 libcifpp-doc_9.0.5-1_all.deb 12276137b3a48767b71285dd60abbd7041cdb699 10259 libcifpp_9.0.5-1_all.buildinfo Checksums-Sha256: 6ee56950e606bb069aa4ce2079c0bedf694b31cd30b481f329a604c0ed49e777 488324 libcifpp-data_9.0.5-1_all.deb 9dd619c4c3915bc6da77ef1101e5374b6cc7d731a54658810d2e07f9c55aef76 3357560 libcifpp-doc_9.0.5-1_all.deb 58a1f2b3a1f54c96bd2f41cefc09b40c5397bbb5bc4db387ec4a82939ef70fb2 10259 libcifpp_9.0.5-1_all.buildinfo Files: 6726dda0ebaf08f504f8cd32bcd2cc33 488324 libs optional libcifpp-data_9.0.5-1_all.deb 74e144894adc10f75b89e60b8bef26af 3357560 doc optional libcifpp-doc_9.0.5-1_all.deb 81a4139a9931164a69dfc8a86becc776 10259 libs optional libcifpp_9.0.5-1_all.buildinfo +------------------------------------------------------------------------------+ | Buildinfo Fri, 21 Nov 2025 16:39:42 +0000 | +------------------------------------------------------------------------------+ Format: 1.0 Source: libcifpp Binary: libcifpp-data libcifpp-doc Architecture: all Version: 9.0.5-1 Checksums-Md5: 6726dda0ebaf08f504f8cd32bcd2cc33 488324 libcifpp-data_9.0.5-1_all.deb 74e144894adc10f75b89e60b8bef26af 3357560 libcifpp-doc_9.0.5-1_all.deb Checksums-Sha1: cf7189784ff11d90b711fb1c6b1e9ebc069528e4 488324 libcifpp-data_9.0.5-1_all.deb 46b2efefa307b71aba733ea0e5865cea0e111eda 3357560 libcifpp-doc_9.0.5-1_all.deb Checksums-Sha256: 6ee56950e606bb069aa4ce2079c0bedf694b31cd30b481f329a604c0ed49e777 488324 libcifpp-data_9.0.5-1_all.deb 9dd619c4c3915bc6da77ef1101e5374b6cc7d731a54658810d2e07f9c55aef76 3357560 libcifpp-doc_9.0.5-1_all.deb Build-Origin: Debian Build-Architecture: amd64 Build-Date: Fri, 21 Nov 2025 16:39:41 +0000 Build-Path: /build/reproducible-path/libcifpp-9.0.5 Installed-Build-Depends: autoconf (= 2.72-3.1), automake (= 1:1.18.1-3), autopoint (= 0.23.2-1), autotools-dev (= 20240727.1), base-files (= 14), base-passwd (= 3.6.8), bash (= 5.3-1), binutils (= 2.45-8), binutils-common (= 2.45-8), binutils-x86-64-linux-gnu (= 2.45-8), bsdextrautils (= 2.41.2-4), build-essential (= 12.12), bzip2 (= 1.0.8-6), ca-certificates (= 20250419), catch2 (= 3.7.1-0.6), cmake (= 4.1.1+really3.31.6-2), cmake-data (= 4.1.1+really3.31.6-2), coreutils (= 9.7-3), cpp (= 4:15.2.0-4), cpp-15 (= 15.2.0-8), cpp-15-x86-64-linux-gnu (= 15.2.0-8), cpp-x86-64-linux-gnu (= 4:15.2.0-4), dash (= 0.5.12-12), debconf (= 1.5.91), debhelper (= 13.28), debianutils (= 5.23.2), dh-autoreconf (= 21), dh-strip-nondeterminism (= 1.15.0-1), diffutils (= 1:3.12-1), docutils-common (= 0.22.3+dfsg-1), doxygen (= 1.9.8+ds-2.1), dpkg (= 1.22.21), dpkg-dev (= 1.22.21), dwz (= 0.16-2), file (= 1:5.46-5), findutils (= 4.10.0-3), fontconfig (= 2.15.0-2.4), fontconfig-config (= 2.15.0-2.4), fonts-dejavu-core (= 2.37-8), fonts-dejavu-mono (= 2.37-8), fonts-font-awesome (= 5.0.10+really4.7.0~dfsg-4.1), fonts-lato (= 2.015-1), g++ (= 4:15.2.0-4), g++-15 (= 15.2.0-8), g++-15-x86-64-linux-gnu (= 15.2.0-8), g++-x86-64-linux-gnu (= 4:15.2.0-4), gcc (= 4:15.2.0-4), gcc-15 (= 15.2.0-8), gcc-15-base (= 15.2.0-8), gcc-15-x86-64-linux-gnu (= 15.2.0-8), gcc-x86-64-linux-gnu (= 4:15.2.0-4), gettext (= 0.23.2-1), gettext-base (= 0.23.2-1), graphviz (= 2.42.4-3), grep (= 3.12-1), groff-base (= 1.23.0-9), gzip (= 1.13-1), hostname (= 3.25), init-system-helpers (= 1.69), intltool-debian (= 0.35.0+20060710.6), libabsl20240722 (= 20240722.0-4), libacl1 (= 2.3.2-2+b1), libann0 (= 1.1.2+doc-9+b1), libaom3 (= 3.13.1-2), libarchive-zip-perl (= 1.68-1), libarchive13t64 (= 3.7.4-4+b1), libasan8 (= 15.2.0-8), libatomic1 (= 15.2.0-8), libattr1 (= 1:2.5.2-3), libaudit-common (= 1:4.1.2-1), libaudit1 (= 1:4.1.2-1), libavif16 (= 1.3.0-1+b1), libbinutils (= 2.45-8), libblkid1 (= 2.41.2-4), libbrotli1 (= 1.1.0-2+b7), libbsd0 (= 0.12.2-2), libbz2-1.0 (= 1.0.8-6), libc-bin (= 2.41-12), libc-dev-bin (= 2.41-12), libc6 (= 2.41-12), libc6-dev (= 2.41-12), libcairo2 (= 1.18.4-1+b1), libcap-ng0 (= 0.8.5-4+b1), libcap2 (= 1:2.75-10+b1), libcatch2-dev (= 3.7.1-0.6), libcc1-0 (= 15.2.0-8), libcdt5 (= 2.42.4-3), libcgraph6 (= 2.42.4-3), libclang-cpp19 (= 1:19.1.7-10.1), libclang1-19 (= 1:19.1.7-10.1), libcom-err2 (= 1.47.2-3+b3), libcrypt-dev (= 1:4.5.1-1), libcrypt1 (= 1:4.5.1-1), libctf-nobfd0 (= 2.45-8), libctf0 (= 2.45-8), libcurl4t64 (= 8.17.0-2), libdatrie1 (= 0.2.13-4), libdav1d7 (= 1.5.2-1), libdb5.3t64 (= 5.3.28+dfsg2-10), libde265-0 (= 1.0.16-1), libdebconfclient0 (= 0.281), libdebhelper-perl (= 13.28), libdeflate0 (= 1.23-2), libdpkg-perl (= 1.22.21), libedit2 (= 3.1-20250104-1), libeigen3-dev (= 3.4.0-5), libelf1t64 (= 0.194-1), libexpat1 (= 2.7.3-1), libffi8 (= 3.5.2-2), libfile-stripnondeterminism-perl (= 1.15.0-1), libfmt10 (= 10.1.1+ds1-4), libfontconfig1 (= 2.15.0-2.4), libfreetype6 (= 2.13.3+dfsg-1), libfribidi0 (= 1.0.16-3), libgav1-1 (= 0.19.0-3+b1), libgcc-15-dev (= 15.2.0-8), libgcc-s1 (= 15.2.0-8), libgcrypt20 (= 1.11.2-3), libgd3 (= 2.3.3-13), libgdbm-compat4t64 (= 1.26-1), libgdbm6t64 (= 1.26-1), libglib2.0-0t64 (= 2.86.2-1), libgmp10 (= 2:6.3.0+dfsg-5), libgnutls30t64 (= 3.8.10-3), libgomp1 (= 15.2.0-8), libgpg-error0 (= 1.56-2), libgprofng0 (= 2.45-8), libgraphite2-3 (= 1.3.14-11), libgssapi-krb5-2 (= 1.22.1-2), libgts-0.7-5t64 (= 0.7.6+darcs121130-5.2+b1), libgvc6 (= 2.42.4-3), libgvpr2 (= 2.42.4-3), libharfbuzz0b (= 12.1.0-1), libheif-plugin-dav1d (= 1.20.2-2+b1), libheif-plugin-libde265 (= 1.20.2-2+b1), libheif1 (= 1.20.2-2+b1), libhogweed6t64 (= 3.10.2-1), libhwasan0 (= 15.2.0-8), libice6 (= 2:1.1.1-1), libidn2-0 (= 2.3.8-4), libimagequant0 (= 4.4.0-3), libisl23 (= 0.27-1), libitm1 (= 15.2.0-8), libjansson4 (= 2.14-2+b3), libjbig0 (= 2.1-6.1+b2), libjpeg62-turbo (= 1:2.1.5-4), libjs-jquery (= 3.7.1+dfsg+~3.5.33-1), libjs-sphinxdoc (= 8.2.3-9), libjson-perl (= 4.10000-1), libjsoncpp26 (= 1.9.6-5), libk5crypto3 (= 1.22.1-2), libkeyutils1 (= 1.6.3-6), libkrb5-3 (= 1.22.1-2), libkrb5support0 (= 1.22.1-2), liblab-gamut1 (= 2.42.4-3), libldap2 (= 2.6.10+dfsg-1), liblerc4 (= 4.0.0+ds-5), libllvm19 (= 1:19.1.7-10.1), liblsan0 (= 15.2.0-8), libltdl7 (= 2.5.4-7), liblz4-1 (= 1.10.0-6), liblzma5 (= 5.8.1-2), libmagic-mgc (= 1:5.46-5), libmagic1t64 (= 1:5.46-5), libmd0 (= 1.1.0-2+b1), libmount1 (= 2.41.2-4), libmpc3 (= 1.3.1-2), libmpfr6 (= 4.2.2-2), libncursesw6 (= 6.5+20250216-2), libnettle8t64 (= 3.10.2-1), libnghttp2-14 (= 1.64.0-1.1+b1), libnghttp3-9 (= 1.12.0-1), libngtcp2-16 (= 1.16.0-1), libngtcp2-crypto-ossl0 (= 1.16.0-1), libp11-kit0 (= 0.25.10-1), libpam-modules (= 1.7.0-5), libpam-modules-bin (= 1.7.0-5), libpam-runtime (= 1.7.0-5), libpam0g (= 1.7.0-5), libpango-1.0-0 (= 1.56.3-2), libpangocairo-1.0-0 (= 1.56.3-2), libpangoft2-1.0-0 (= 1.56.3-2), libpathplan4 (= 2.42.4-3), libpcre2-16-0 (= 10.46-1), libpcre2-32-0 (= 10.46-1), libpcre2-8-0 (= 10.46-1), libpcre2-dev (= 10.46-1), libpcre2-posix3 (= 10.46-1), libperl5.40 (= 5.40.1-7), libpipeline1 (= 1.5.8-1), libpixman-1-0 (= 0.46.4-1), libpkgconf3 (= 1.8.1-4), libpng16-16t64 (= 1.6.50-1), libproc2-0 (= 2:4.0.4-9), libpsl5t64 (= 0.21.2-1.1+b1), libpython3-stdlib (= 3.13.7-1), libpython3.13-minimal (= 3.13.9-1), libpython3.13-stdlib (= 3.13.9-1), libquadmath0 (= 15.2.0-8), librav1e0.8 (= 0.8.1-6), libreadline8t64 (= 8.3-3), librhash1 (= 1.4.6-1), librtmp1 (= 2.4+20151223.gitfa8646d.1-3), libsasl2-2 (= 2.1.28+dfsg1-10), libsasl2-modules-db (= 2.1.28+dfsg1-10), libseccomp2 (= 2.6.0-2), libselinux1 (= 3.9-2), libsframe2 (= 2.45-8), libsharpyuv0 (= 1.5.0-0.1), libsm6 (= 2:1.2.6-1), libsmartcols1 (= 2.41.2-4), libsqlite3-0 (= 3.46.1-8), libssh2-1t64 (= 1.11.1-1), libssl3t64 (= 3.5.4-1), libstdc++-15-dev (= 15.2.0-8), libstdc++6 (= 15.2.0-8), libsvtav1enc2 (= 2.3.0+dfsg-1), libsystemd0 (= 259~rc1-1), libtasn1-6 (= 4.20.0-2), libthai-data (= 0.1.29-2), libthai0 (= 0.1.29-2+b1), libtiff6 (= 4.7.1-1), libtinfo6 (= 6.5+20250216-2), libtool (= 2.5.4-7), libtsan2 (= 15.2.0-8), libubsan1 (= 15.2.0-8), libuchardet0 (= 0.0.8-2), libudev1 (= 259~rc1-1), libunistring5 (= 1.3-2), libuuid1 (= 2.41.2-4), libuv1t64 (= 1.51.0-2), libwebp7 (= 1.5.0-0.1), libx11-6 (= 2:1.8.12-1), libx11-data (= 2:1.8.12-1), libxapian30 (= 1.4.29-3), libxau6 (= 1:1.0.11-1), libxaw7 (= 2:1.0.16-1), libxcb-render0 (= 1.17.0-2+b1), libxcb-shm0 (= 1.17.0-2+b1), libxcb1 (= 1.17.0-2+b1), libxdmcp6 (= 1:1.1.5-1), libxext6 (= 2:1.3.4-1+b3), libxml2-16 (= 2.15.1+dfsg-0.4), libxmu6 (= 2:1.1.3-3+b4), libxpm4 (= 1:3.5.17-1+b3), libxrender1 (= 1:0.9.12-1), libxslt1.1 (= 1.1.43-0.3), libxt6t64 (= 1:1.2.1-1.3), libxxhash0 (= 0.8.3-2), libyaml-0-2 (= 0.2.5-2), libyuv0 (= 0.0.1919.20250919-1), libz3-4 (= 4.13.3-1), libzstd1 (= 1.5.7+dfsg-2), linux-libc-dev (= 6.17.8-1), m4 (= 1.4.20-2), make (= 4.4.1-3), man-db (= 2.13.1-1), mawk (= 1.3.4.20250131-1), media-types (= 14.0.0), ncurses-base (= 6.5+20250216-2), ncurses-bin (= 6.5+20250216-2), netbase (= 6.5), openssl (= 3.5.4-1), openssl-provider-legacy (= 3.5.4-1), patch (= 2.8-2), perl (= 5.40.1-7), perl-base (= 5.40.1-7), perl-modules-5.40 (= 5.40.1-7), pkg-config (= 1.8.1-4), pkgconf (= 1.8.1-4), pkgconf-bin (= 1.8.1-4), po-debconf (= 1.0.21+nmu1), procps (= 2:4.0.4-9), python-babel-localedata (= 2.17.0-1), python3 (= 3.13.7-1), python3-alabaster (= 0.7.16-0.1), python3-babel (= 2.17.0-1), python3-breathe (= 4.36.0-2), python3-bs4 (= 4.14.2-1), python3-certifi (= 2025.1.31+ds-1), python3-chardet (= 5.2.0+dfsg-2), python3-charset-normalizer (= 3.4.3-1), python3-defusedxml (= 0.7.1-3), python3-docutils (= 0.22.3+dfsg-1), python3-exhale (= 0.3.7-1), python3-idna (= 3.10-1), python3-imagesize (= 1.4.1-1), python3-jinja2 (= 3.1.6-1), python3-linkify-it (= 2.0.3-1), python3-lxml (= 6.0.2-1), python3-markdown-it (= 3.0.0-3), python3-markupsafe (= 3.0.3-1), python3-mdit-py-plugins (= 0.5.0-1), python3-mdurl (= 0.1.2-1), python3-minimal (= 3.13.7-1), python3-myst-parser (= 4.0.1-1), python3-packaging (= 25.0-1), python3-pygments (= 2.18.0+dfsg-2), python3-requests (= 2.32.5+dfsg-1), python3-roman-numerals (= 3.1.0-2), python3-six (= 1.17.0-1), python3-snowballstemmer (= 3.0.1-1), python3-soupsieve (= 2.7-2), python3-sphinx (= 8.2.3-9), python3-sphinx-rtd-theme (= 3.0.2+dfsg-3), python3-sphinxcontrib.jquery (= 4.1-6), python3-typing-extensions (= 4.15.0-1), python3-uc-micro (= 1.0.3-1), python3-urllib3 (= 2.5.0-1), python3-yaml (= 6.0.2-2), python3.13 (= 3.13.9-1), python3.13-minimal (= 3.13.9-1), readline-common (= 8.3-3), rpcsvc-proto (= 1.4.3-1), sed (= 4.9-2), sensible-utils (= 0.0.26), sgml-base (= 1.31+nmu1), sphinx-common (= 8.2.3-9), sphinx-rtd-theme-common (= 3.0.2+dfsg-3), sysvinit-utils (= 3.15-6), tar (= 1.35+dfsg-3.1), tzdata (= 2025b-5), util-linux (= 2.41.2-4), x11-common (= 1:7.7+26), xml-core (= 0.19), xz-utils (= 5.8.1-2), zlib1g (= 1:1.3.dfsg+really1.3.1-1+b1), zlib1g-dev (= 1:1.3.dfsg+really1.3.1-1+b1) Environment: DEB_BUILD_OPTIONS="parallel=6" LANG="C.UTF-8" LC_COLLATE="C.UTF-8" LC_CTYPE="C.UTF-8" SOURCE_DATE_EPOCH="1763627154" +------------------------------------------------------------------------------+ | Package contents Fri, 21 Nov 2025 16:39:42 +0000 | +------------------------------------------------------------------------------+ libcifpp-data_9.0.5-1_all.deb ----------------------------- new Debian package, version 2.0. size 488324 bytes: control archive=2540 bytes. 38 bytes, 1 lines conffiles 329 bytes, 20 lines * config #!/bin/sh 632 bytes, 18 lines control 430 bytes, 6 lines md5sums 1109 bytes, 49 lines * postinst #!/bin/sh 512 bytes, 27 lines * postrm #!/bin/sh 2257 bytes, 21 lines templates Package: libcifpp-data Source: libcifpp Version: 9.0.5-1 Architecture: all Maintainer: Debian Med Packaging Team Installed-Size: 10592 Depends: debconf (>= 0.5) | debconf-2.0 Breaks: libcifpp5.2 (<< 5.0.0-1) Replaces: libcifpp5.2 (<< 5.0.0-1) Section: libs Priority: optional Multi-Arch: foreign Homepage: https://github.com/PDB-REDO/libcifpp Description: Data files for libcifpp Libcifpp is a C++ library used to create and manipulate mmCIF and PDB files containing macro molecular structure information. . This package contains the architecture independent data for the library. drwxr-xr-x root/root 0 2025-11-20 08:25 ./ drwxr-xr-x root/root 0 2025-11-20 08:25 ./etc/ drwxr-xr-x root/root 0 2025-11-20 08:25 ./etc/cron.weekly/ -rwxr-xr-x root/root 2080 2025-11-20 08:25 ./etc/cron.weekly/update-libcifpp-data drwxr-xr-x root/root 0 2025-11-20 08:25 ./etc/libcifpp/ drwxr-xr-x root/root 0 2025-11-20 08:25 ./etc/libcifpp/cache-update.d/ drwxr-xr-x root/root 0 2025-11-20 08:25 ./usr/ drwxr-xr-x root/root 0 2025-11-20 08:25 ./usr/share/ drwxr-xr-x root/root 0 2025-11-20 08:25 ./usr/share/doc/ drwxr-xr-x root/root 0 2025-11-20 08:25 ./usr/share/doc/libcifpp-data/ -rw-r--r-- root/root 2403 2025-11-20 08:25 ./usr/share/doc/libcifpp-data/changelog.Debian.gz -rw-r--r-- root/root 3528 2025-11-05 12:18 ./usr/share/doc/libcifpp-data/changelog.gz -rw-r--r-- root/root 4363 2025-11-20 08:25 ./usr/share/doc/libcifpp-data/copyright drwxr-xr-x root/root 0 2025-11-20 08:25 ./usr/share/libcifpp/ -rw-r--r-- root/root 104682 2025-11-05 12:18 ./usr/share/libcifpp/mmcif_ddl.dic -rw-r--r-- root/root 4936343 2025-11-05 12:18 ./usr/share/libcifpp/mmcif_ma.dic -rw-r--r-- root/root 5768498 2025-11-05 12:18 ./usr/share/libcifpp/mmcif_pdbx.dic libcifpp-doc_9.0.5-1_all.deb ---------------------------- new Debian package, version 2.0. size 3357560 bytes: control archive=19716 bytes. 578 bytes, 16 lines control 80410 bytes, 712 lines md5sums Package: libcifpp-doc Source: libcifpp Version: 9.0.5-1 Architecture: all Maintainer: Debian Med Packaging Team Installed-Size: 15808 Depends: libboost-regex-dev, zlib1g-dev Section: doc Priority: optional Homepage: https://github.com/PDB-REDO/libcifpp Description: Development files for libcifpp Libcifpp is a C++ library used to create and manipulate mmCIF and PDB files containing macro molecular structure information. . This specific package contains the documentation you can use to develop new software using libcifpp. drwxr-xr-x root/root 0 2025-11-20 08:25 ./ drwxr-xr-x root/root 0 2025-11-20 08:25 ./usr/ drwxr-xr-x root/root 0 2025-11-20 08:25 ./usr/share/ drwxr-xr-x root/root 0 2025-11-20 08:25 ./usr/share/doc-base/ -rw-r--r-- root/root 306 2025-11-20 08:25 ./usr/share/doc-base/libcifpp-doc.libcifpp-doc drwxr-xr-x root/root 0 2025-11-20 08:25 ./usr/share/doc/ drwxr-xr-x root/root 0 2025-11-20 08:25 ./usr/share/doc/libcifpp-doc/ -rw-r--r-- root/root 2403 2025-11-20 08:25 ./usr/share/doc/libcifpp-doc/changelog.Debian.gz -rw-r--r-- root/root 3528 2025-11-05 12:18 ./usr/share/doc/libcifpp-doc/changelog.gz -rw-r--r-- root/root 4363 2025-11-20 08:25 ./usr/share/doc/libcifpp-doc/copyright drwxr-xr-x root/root 0 2025-11-20 08:25 ./usr/share/doc/libcifpp/ drwxr-xr-x root/root 0 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/ drwxr-xr-x root/root 0 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/ -rw-r--r-- root/root 440 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1atom__type__traits.rst.txt -rw-r--r-- root/root 520 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1category.rst.txt -rw-r--r-- root/root 251 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1cell.rst.txt -rw-r--r-- root/root 267 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1compound.rst.txt -rw-r--r-- root/root 300 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1compound__factory.rst.txt -rw-r--r-- root/root 296 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1compound__source.rst.txt -rw-r--r-- root/root 272 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1condition.rst.txt -rw-r--r-- root/root 359 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1conditional__iterator__proxy.rst.txt -rw-r--r-- root/root 263 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1crystal.rst.txt -rw-r--r-- root/root 383 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1datablock.rst.txt -rw-r--r-- root/root 421 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1duplicate__key__error.rst.txt -rw-r--r-- root/root 359 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1file.rst.txt -rw-r--r-- root/root 411 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1fill__out__streambuf.rst.txt -rw-r--r-- root/root 508 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1gzio_1_1basic__ifstream.rst.txt -rw-r--r-- root/root 541 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1gzio_1_1basic__igzip__streambuf.rst.txt -rw-r--r-- root/root 584 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1gzio_1_1basic__istream.rst.txt -rw-r--r-- root/root 508 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1gzio_1_1basic__ofstream.rst.txt -rw-r--r-- root/root 541 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1gzio_1_1basic__ogzip__streambuf.rst.txt -rw-r--r-- root/root 584 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1gzio_1_1basic__ostream.rst.txt -rw-r--r-- root/root 764 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1gzio_1_1basic__streambuf.rst.txt -rw-r--r-- root/root 505 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1identity__matrix.rst.txt -rw-r--r-- root/root 247 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1item.rst.txt -rw-r--r-- root/root 306 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1iterator__impl.rst.txt -rw-r--r-- root/root 376 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1iterator__impl_3_01Category_00_01T_01_4.rst.txt -rw-r--r-- root/root 360 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1iterator__impl_3_01Category_01_4.rst.txt -rw-r--r-- root/root 310 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1iterator__proxy.rst.txt -rw-r--r-- root/root 459 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1matrix.rst.txt -rw-r--r-- root/root 506 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1matrix__cofactors.rst.txt -rw-r--r-- root/root 745 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1matrix__expression.rst.txt -rw-r--r-- root/root 492 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1matrix__fixed.rst.txt -rw-r--r-- root/root 572 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1matrix__matrix__multiplication.rst.txt -rw-r--r-- root/root 570 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1matrix__scalar__multiplication.rst.txt -rw-r--r-- root/root 521 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1matrix__subtraction.rst.txt -rw-r--r-- root/root 413 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1missing__key__error.rst.txt -rw-r--r-- root/root 258 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1mm_1_1atom.rst.txt -rw-r--r-- root/root 376 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1mm_1_1branch.rst.txt -rw-r--r-- root/root 424 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1mm_1_1monomer.rst.txt -rw-r--r-- root/root 382 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1mm_1_1polymer.rst.txt -rw-r--r-- root/root 506 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1mm_1_1residue.rst.txt -rw-r--r-- root/root 278 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1mm_1_1structure.rst.txt -rw-r--r-- root/root 416 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1mm_1_1sugar.rst.txt -rw-r--r-- root/root 433 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1multiple__results__error.rst.txt -rw-r--r-- root/root 386 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1parse__error.rst.txt -rw-r--r-- root/root 408 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1parser.rst.txt -rw-r--r-- root/root 285 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1progress__bar.rst.txt -rw-r--r-- root/root 311 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1quaternion__type.rst.txt -rw-r--r-- root/root 357 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1row.rst.txt -rw-r--r-- root/root 271 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1row__handle.rst.txt -rw-r--r-- root/root 400 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1row__initializer.rst.txt -rw-r--r-- root/root 422 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1sac__parser.rst.txt -rw-r--r-- root/root 394 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1spacegroup.rst.txt -rw-r--r-- root/root 307 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1spherical__dots.rst.txt -rw-r--r-- root/root 477 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1sub__matrix.rst.txt -rw-r--r-- root/root 510 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1symmetric__matrix.rst.txt -rw-r--r-- root/root 540 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1symmetric__matrix__fixed.rst.txt -rw-r--r-- root/root 291 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1transformation.rst.txt -rw-r--r-- root/root 442 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1validation__category__impl.rst.txt -rw-r--r-- root/root 424 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1validation__exception.rst.txt -rw-r--r-- root/root 271 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1validator.rst.txt -rw-r--r-- root/root 304 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/classcif_1_1validator__factory.rst.txt -rw-r--r-- root/root 293 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/define_exports_8hpp_1a34c1ecdfe0e74030d387cc4e3db0f20d.rst.txt -rw-r--r-- root/root 263 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/define_exports_8hpp_1a42700069adcc34faeda32076bd173dc1.rst.txt -rw-r--r-- root/root 260 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/define_exports_8hpp_1aab9ff10a498bf7bb72ce703e00c6551c.rst.txt -rw-r--r-- root/root 284 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/define_exports_8hpp_1af93831e3c71f1f7a80712cd6b3812992.rst.txt -rw-r--r-- root/root 258 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/define_utilities_8hpp_1abd165ee6474b5b75bf075842fff13a04.rst.txt -rw-r--r-- root/root 258 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/define_utilities_8hpp_1ae2fe1725bb5e9823d089c46b9ed5266e.rst.txt -rw-r--r-- root/root 888 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/dir_cif++.rst.txt -rw-r--r-- root/root 369 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/dir_cif++_pdb.rst.txt -rw-r--r-- root/root 238 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/enum_model_8hpp_1a6085af7e2c3294d3d5520e387757e8dd.rst.txt -rw-r--r-- root/root 256 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/enum_model_8hpp_1a84341c70c74ab432b534a3bac3034dbb.rst.txt -rw-r--r-- root/root 263 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/enum_namespacecif_1a22f8e0bb538e176ebddfe89c7ef03a6d.rst.txt -rw-r--r-- root/root 260 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/enum_namespacecif_1a339253d4b856d267db110e2e55b6fa46.rst.txt -rw-r--r-- root/root 236 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/enum_namespacecif_1a636b6271c6af17a0d73dbe4557061c03.rst.txt -rw-r--r-- root/root 237 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/enum_namespacecif_1a701ee5c69b8bf4a14c0807d32581e87d.rst.txt -rw-r--r-- root/root 261 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/enum_namespacecif_1a9579bd6dc036aa07dcb73e9724cd4f54.rst.txt -rw-r--r-- root/root 243 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/enum_namespacecif_1abd4c1fac9978e10628b9317d386d9287.rst.txt -rw-r--r-- root/root 257 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/enum_namespacecif_1ae5e65dddeeceb84cd55b772eaca216c7.rst.txt -rw-r--r-- root/root 257 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/enum_namespacecif_1aeffd144259eee54425fd70df1a4c119a.rst.txt -rw-r--r-- root/root 253 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/enum_utilities_8hpp_1a2dfb81ba6ea862bc2483f1fed3477dcf.rst.txt -rw-r--r-- root/root 250 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/enum_utilities_8hpp_1a8fd997c36131df71885f44abf2297523.rst.txt -rw-r--r-- root/root 751 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++.hpp.rst.txt -rw-r--r-- root/root 1409 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_atom_type.hpp.rst.txt -rw-r--r-- root/root 1594 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_category.hpp.rst.txt -rw-r--r-- root/root 2033 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_compound.hpp.rst.txt -rw-r--r-- root/root 4820 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_condition.hpp.rst.txt -rw-r--r-- root/root 984 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_datablock.hpp.rst.txt -rw-r--r-- root/root 640 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_dictionary_parser.hpp.rst.txt -rw-r--r-- root/root 886 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_exports.hpp.rst.txt -rw-r--r-- root/root 1137 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_file.hpp.rst.txt -rw-r--r-- root/root 713 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_format.hpp.rst.txt -rw-r--r-- root/root 695 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_forward_decl.hpp.rst.txt -rw-r--r-- root/root 2066 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_gzio.hpp.rst.txt -rw-r--r-- root/root 1195 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_item.hpp.rst.txt -rw-r--r-- root/root 1131 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_iterator.hpp.rst.txt -rw-r--r-- root/root 2303 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_matrix.hpp.rst.txt -rw-r--r-- root/root 2135 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_model.hpp.rst.txt -rw-r--r-- root/root 815 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_parser.hpp.rst.txt -rw-r--r-- root/root 2132 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_pdb.hpp.rst.txt -rw-r--r-- root/root 500 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_pdb_cif2pdb.hpp.rst.txt -rw-r--r-- root/root 470 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_pdb_io.hpp.rst.txt -rw-r--r-- root/root 500 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_pdb_pdb2cif.hpp.rst.txt -rw-r--r-- root/root 452 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_pdb_tls.hpp.rst.txt -rw-r--r-- root/root 2890 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_point.hpp.rst.txt -rw-r--r-- root/root 2301 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_row.hpp.rst.txt -rw-r--r-- root/root 2226 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_symmetry.hpp.rst.txt -rw-r--r-- root/root 3249 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_text.hpp.rst.txt -rw-r--r-- root/root 2084 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_utilities.hpp.rst.txt -rw-r--r-- root/root 2161 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/file_cif++_validate.hpp.rst.txt -rw-r--r-- root/root 345 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_condition_8hpp_1ae3fb5e492867225091edeba773f91d39.rst.txt -rw-r--r-- root/root 300 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_model_8hpp_1a9bb5822efb054c2979a666d9bfc0913d.rst.txt -rw-r--r-- root/root 324 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_model_8hpp_1aaaea875b497445410924763ba322f0f4.rst.txt -rw-r--r-- root/root 276 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_model_8hpp_1ab82fb33002132ca78f0f0de0855a9883.rst.txt -rw-r--r-- root/root 355 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a00df2cb74b5f9590f7f3e4d64ed08077.rst.txt -rw-r--r-- root/root 371 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a016b23e15d2a1d5f8121a697d7bec68e.rst.txt -rw-r--r-- root/root 338 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a02741e5ba23265cacfda366089d13f00.rst.txt -rw-r--r-- root/root 306 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a04692e2c6a26c3dd823891c93aa68c46.rst.txt -rw-r--r-- root/root 343 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a07568e2424a8b9f3d87c0e7b506f01c8.rst.txt -rw-r--r-- root/root 327 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a07b180b747ac558694dfb1e73503dc71.rst.txt -rw-r--r-- root/root 390 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a0987fe676d4bf9554de808bfe9b13a6b.rst.txt -rw-r--r-- root/root 299 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a0cf4d792e3cf8fb29aa18b8c585b1426.rst.txt -rw-r--r-- root/root 348 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a0e173ffb184bab07d483866b6f2f7274.rst.txt -rw-r--r-- root/root 366 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a0f6dd8dc18df398b116c0c2343c2cfee.rst.txt -rw-r--r-- root/root 385 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a1020ee51b50043210b5e9c8eaecd4c28.rst.txt -rw-r--r-- root/root 311 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a10ff1c475902516ebcd1cf4059ac513b.rst.txt -rw-r--r-- root/root 315 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a1425b605f99bf04eeb638f55c0d91566.rst.txt -rw-r--r-- root/root 303 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a15ce5665ae421c0a3db9fac68c149836.rst.txt -rw-r--r-- root/root 306 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a17188febf04153361cad42eb042da64a.rst.txt -rw-r--r-- root/root 414 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a18461202bb0b0d4d134bc3eb46455776.rst.txt -rw-r--r-- root/root 352 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a1bf743b12f5bba28eab81d100fa6be6f.rst.txt -rw-r--r-- root/root 265 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a1cb6fb0735b49d0e7796d223763718e4.rst.txt -rw-r--r-- root/root 322 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a2190ac2315339dabb5be80f2a8634e29.rst.txt -rw-r--r-- root/root 347 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a23c62f901e53b06d736b955cbb079336.rst.txt -rw-r--r-- root/root 356 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a26cac7b3c044dff1bdcac52425e775f9.rst.txt -rw-r--r-- root/root 353 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a27048ca516d6ab9d61b330b3ae27b37f.rst.txt -rw-r--r-- root/root 280 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a277d04e4939dd9a5167dc90c21c00266.rst.txt -rw-r--r-- root/root 303 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a28d3d6db55465d265cb5b6a7a7d93a6b.rst.txt -rw-r--r-- root/root 403 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a2996a300e6f91f05abb11706b3c3cef2.rst.txt -rw-r--r-- root/root 314 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a2a94aaedfb605f4e6a403e8790ee4cfd.rst.txt -rw-r--r-- root/root 302 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a2b6f06460cea1b44770b316c8c5d4b06.rst.txt -rw-r--r-- root/root 339 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a2bce0a62772ef8e6c5128b36d4cbb9ce.rst.txt -rw-r--r-- root/root 360 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a2db5caf5ac5cd4376f29255fa9eebbc0.rst.txt -rw-r--r-- root/root 295 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a2e9af2d268ca7932d3b5df430dfabfe7.rst.txt -rw-r--r-- root/root 328 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a302fdd5a6fea6ea6a874f4e635bd43e3.rst.txt -rw-r--r-- root/root 265 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a31bf31f1feff330b402ab96d51b4f458.rst.txt -rw-r--r-- root/root 300 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a337647d2ca82951e159b244e0a892f0e.rst.txt -rw-r--r-- root/root 255 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a39ae1da888a5c8a6ee7f1438b78b7734.rst.txt -rw-r--r-- root/root 358 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a3f5264d06e1b2326aadfae8b3b114414.rst.txt -rw-r--r-- root/root 269 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a3fa150213a7a95d9d013b5faeae2d5f2.rst.txt -rw-r--r-- root/root 351 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a444f4493c315230d1137f13d0e28920c.rst.txt -rw-r--r-- root/root 387 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a449c5d43d72a9779d3338c2882d13e36.rst.txt -rw-r--r-- root/root 383 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a470ad3905a4aa5fe52da998640740ab7.rst.txt -rw-r--r-- root/root 364 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a490147eab255051c58bc3d7d16471e17.rst.txt -rw-r--r-- root/root 361 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a4c27e27d4cb70a2e13cf2efb05ccd325.rst.txt -rw-r--r-- root/root 322 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a4c9bbe02598ccb179023f7d9ed18f4e9.rst.txt -rw-r--r-- root/root 337 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a4da118af7b65801fd61c48356e67e4a1.rst.txt -rw-r--r-- root/root 367 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a4f2dd5c988ef77316bb4fdda57146fd5.rst.txt -rw-r--r-- root/root 351 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a52c1d908e7a659686a16cbde3684f7a1.rst.txt -rw-r--r-- root/root 358 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a561da00d019d125f7356b8717771b6b6.rst.txt -rw-r--r-- root/root 290 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a57a7530364c9dfa84f8607824e6d70e3.rst.txt -rw-r--r-- root/root 310 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a5a94d01c3d87fb157ae322b347129e56.rst.txt -rw-r--r-- root/root 364 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a5c256bdffd9190e69c087e64b69d786d.rst.txt -rw-r--r-- root/root 417 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a643804a021f65a34aa75f121f3023104.rst.txt -rw-r--r-- root/root 300 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a65ac1856b4a8a6675e6a0f0d9b5edfaa.rst.txt -rw-r--r-- root/root 302 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a674345a2d0fb9af13bea9c833076cec0.rst.txt -rw-r--r-- root/root 296 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a7555a1d6c76bc1cef206fab9a8d67fad.rst.txt -rw-r--r-- root/root 358 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a75df878566a514b909141bad937280f4.rst.txt -rw-r--r-- root/root 306 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a7b0b6dec945a1157aa9d455fd35494df.rst.txt -rw-r--r-- root/root 333 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a7da448991e41eef2fa6dbf113827f958.rst.txt -rw-r--r-- root/root 361 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a867dc9c21324a3e65a931bb4d7160a9e.rst.txt -rw-r--r-- root/root 322 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a86caa43dc2def46857ab3eb037b63f2b.rst.txt -rw-r--r-- root/root 302 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a8864838e9763e207066cdbb217920f21.rst.txt -rw-r--r-- root/root 355 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a89f948a7392e875f87012ca961060cb3.rst.txt -rw-r--r-- root/root 344 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a8c224d1a874aab66b434422f03ed85d4.rst.txt -rw-r--r-- root/root 337 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a8c495f22c9ff90161b1ae539552e02aa.rst.txt -rw-r--r-- root/root 364 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a8c894208d05a89ca79ed66421d241f0f.rst.txt -rw-r--r-- root/root 284 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a8f9736ac0d35666ef1a68f02705b8507.rst.txt -rw-r--r-- root/root 299 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a94db0d39a3d82bde5ae35a2d5a729dce.rst.txt -rw-r--r-- root/root 288 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a96cecd643b7fedefcee808419ac8db73.rst.txt -rw-r--r-- root/root 389 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a9a07496ad027d7f53edeba05b8946d15.rst.txt -rw-r--r-- root/root 364 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a9a46e6bb8184b5c4b2867e50d4bafd46.rst.txt -rw-r--r-- root/root 316 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a9dbdac69f3a21d391ece6cc214da3075.rst.txt -rw-r--r-- root/root 324 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a9de541062d328307198b32e4680ac29b.rst.txt -rw-r--r-- root/root 277 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1a9ef12a84362871f9b37c36d526dcdc87.rst.txt -rw-r--r-- root/root 312 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1aa0722da1df2e70c4c68cb1e512978cae.rst.txt -rw-r--r-- root/root 306 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1aa629e0bd1ddd07f3ffd7bde1bf0bf0fb.rst.txt -rw-r--r-- root/root 403 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1aa697ec53ac311721d137e96508fe6268.rst.txt -rw-r--r-- root/root 412 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1aa6ba3ba2b2b2dcbabee10461e0b8cad3.rst.txt -rw-r--r-- root/root 368 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1aae2f02104c912443c2f40b2647803ccb.rst.txt -rw-r--r-- root/root 299 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1aaede7d3ae547f8c18450a83b6bcc42e2.rst.txt -rw-r--r-- root/root 367 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ab173f10abbd57122dbfd669f30af5509.rst.txt -rw-r--r-- root/root 355 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ab4b982e1dc64e54d408cf8a9a99a2851.rst.txt -rw-r--r-- root/root 293 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ab5bf28cddf2fe7bbfe60778c60f9082e.rst.txt -rw-r--r-- root/root 358 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ab80f7d084a897f8654fecdcbe4c598ba.rst.txt -rw-r--r-- root/root 367 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ab91dfb39e9ee43942c5d384f161b97f3.rst.txt -rw-r--r-- root/root 468 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ab97c8f7af37ad32ee1e96218eef8e0e1.rst.txt -rw-r--r-- root/root 346 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ab9c1b63f260c9ccc3740971d6ca755c7.rst.txt -rw-r--r-- root/root 363 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1abbc95fb717f14cca92d73ff5ed83c685.rst.txt -rw-r--r-- root/root 291 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1abce4bb85397326d1c0a079f43048fa18.rst.txt -rw-r--r-- root/root 302 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ac0219abe114a15fecf35b9305c6a51b9.rst.txt -rw-r--r-- root/root 299 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ac0f43cdcc8b1ba95aae5fa92f623993d.rst.txt -rw-r--r-- root/root 319 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ac29c380eff41208bca6fce85b26cbb0b.rst.txt -rw-r--r-- root/root 273 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ac3d9a984c107208b0abbabe5f9e05289.rst.txt -rw-r--r-- root/root 300 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ac4c468df4c799fd242842a86e523bc3e.rst.txt -rw-r--r-- root/root 277 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1acb24b83a370551b91948baf851bc3ba4.rst.txt -rw-r--r-- root/root 355 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1acc0e956a0d6382e85c6ecb631e2edd21.rst.txt -rw-r--r-- root/root 302 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1acde0f42396a36ed1d56f59e8754968b9.rst.txt -rw-r--r-- root/root 330 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ad0c5beb6c8ad7621c2ec415432b33c48.rst.txt -rw-r--r-- root/root 382 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ad3654e07e2f3102ac503499fa51d930f.rst.txt -rw-r--r-- root/root 329 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ad57ceedd9a74df6a781247532781c5fa.rst.txt -rw-r--r-- root/root 325 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ad6daf4b6c782edbfeb0236e71f9e6ae1.rst.txt -rw-r--r-- root/root 373 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ad8a62060b4918e8fcdba571adcde4295.rst.txt -rw-r--r-- root/root 318 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1adecaf77ddb0b38da346fecf70b5df2e0.rst.txt -rw-r--r-- root/root 343 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ae025ebbaf906da6b0e66d3fa6657c536.rst.txt -rw-r--r-- root/root 363 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ae338b65793c18872e8bcdfe6a534c83b.rst.txt -rw-r--r-- root/root 321 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1ae8f1330ded658c851bda5859f2e071bc.rst.txt -rw-r--r-- root/root 388 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1aeb2069c34c7d86acc4418d3740adf5d8.rst.txt -rw-r--r-- root/root 292 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1aeb28b4b173153589179f4f7b5d20c063.rst.txt -rw-r--r-- root/root 316 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1aee7c4c79e259a8c70f8534f1ce3e39a5.rst.txt -rw-r--r-- root/root 283 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1af443771f125de0bdc78726a4235fc1a3.rst.txt -rw-r--r-- root/root 321 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1af6e09fd9a34540b7718e7f76a0029629.rst.txt -rw-r--r-- root/root 300 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_namespacecif_1afdee9d0ba328b6dc1219e83b128b003b.rst.txt -rw-r--r-- root/root 372 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a022f50570f0370ddce514869b65fb6ae.rst.txt -rw-r--r-- root/root 393 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a0ca52e86fd5c866cb07ee1d2bd6e0be6.rst.txt -rw-r--r-- root/root 336 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a0cdfe208e415aa2b34e1277e5de112cb.rst.txt -rw-r--r-- root/root 303 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a0d8dcb296d80df362a6d47d62b9e01c9.rst.txt -rw-r--r-- root/root 318 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a2bcb3bdc779f63c96a1eb84e45ff4c20.rst.txt -rw-r--r-- root/root 396 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a346afa86961c301f1d4fa6486584e7c7.rst.txt -rw-r--r-- root/root 396 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a3beb1e1704887c34c3ffcf62ba4c93a2.rst.txt -rw-r--r-- root/root 336 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a429736e305a06f11b86700d76f8b1ac3.rst.txt -rw-r--r-- root/root 306 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a5f015134e46f13c6ef9eb9ed84b66d1a.rst.txt -rw-r--r-- root/root 351 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a631597613cf60653370f704184d3b9d7.rst.txt -rw-r--r-- root/root 336 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a8442a8beb3ec3862b1223091ba279b3f.rst.txt -rw-r--r-- root/root 408 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1a965679d61a80ce38487bb63eb1759281.rst.txt -rw-r--r-- root/root 450 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1aa0d4c3ad5c58499e9cf38a4dd42d11d1.rst.txt -rw-r--r-- root/root 363 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1aa1addf5082e01849dc7b0af93aa0d34d.rst.txt -rw-r--r-- root/root 336 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1aa57fd6d1c296ee70c9784fc59382d7c1.rst.txt -rw-r--r-- root/root 354 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1aae0b184e743aa515b75da7b3c494b8ee.rst.txt -rw-r--r-- root/root 348 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1ac681cb3a6237bc71dcba0e88fb1c0832.rst.txt -rw-r--r-- root/root 300 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_pdb_8hpp_1affa360f702ea4f0811f02b87211294c0.rst.txt -rw-r--r-- root/root 349 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/function_symmetry_8hpp_1a5a53cac9d72c839c804fd7619f764d67.rst.txt -rw-r--r-- root/root 223 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/library_root.rst.txt -rw-r--r-- root/root 14162 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/namespace_cif.rst.txt -rw-r--r-- root/root 298 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/namespace_cif__colour.rst.txt -rw-r--r-- root/root 194 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/namespace_cif__colour__detail.rst.txt -rw-r--r-- root/root 74 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/namespace_cif__detail.rst.txt -rw-r--r-- root/root 840 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/namespace_cif__gzio.rst.txt -rw-r--r-- root/root 254 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/namespace_cif__literals.rst.txt -rw-r--r-- root/root 878 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/namespace_cif__mm.rst.txt -rw-r--r-- root/root 1348 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/namespace_cif__pdb.rst.txt -rw-r--r-- root/root 104 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/page_deprecated.rst.txt -rw-r--r-- root/root 2119 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++.hpp.rst.txt -rw-r--r-- root/root 6663 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_atom_type.hpp.rst.txt -rw-r--r-- root/root 27849 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_category.hpp.rst.txt -rw-r--r-- root/root 8262 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_compound.hpp.rst.txt -rw-r--r-- root/root 34395 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_condition.hpp.rst.txt -rw-r--r-- root/root 4492 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_datablock.hpp.rst.txt -rw-r--r-- root/root 2024 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_dictionary_parser.hpp.rst.txt -rw-r--r-- root/root 1498 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_exports.hpp.rst.txt -rw-r--r-- root/root 4075 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_file.hpp.rst.txt -rw-r--r-- root/root 3796 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_format.hpp.rst.txt -rw-r--r-- root/root 2102 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_forward_decl.hpp.rst.txt -rw-r--r-- root/root 26863 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_gzio.hpp.rst.txt -rw-r--r-- root/root 18343 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_item.hpp.rst.txt -rw-r--r-- root/root 21553 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_iterator.hpp.rst.txt -rw-r--r-- root/root 18539 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_matrix.hpp.rst.txt -rw-r--r-- root/root 28512 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_model.hpp.rst.txt -rw-r--r-- root/root 8732 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_parser.hpp.rst.txt -rw-r--r-- root/root 3602 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_pdb.hpp.rst.txt -rw-r--r-- root/root 1919 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_pdb_cif2pdb.hpp.rst.txt -rw-r--r-- root/root 1894 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_pdb_io.hpp.rst.txt -rw-r--r-- root/root 1915 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_pdb_pdb2cif.hpp.rst.txt -rw-r--r-- root/root 1877 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_pdb_tls.hpp.rst.txt -rw-r--r-- root/root 24802 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_point.hpp.rst.txt -rw-r--r-- root/root 9991 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_row.hpp.rst.txt -rw-r--r-- root/root 12863 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_symmetry.hpp.rst.txt -rw-r--r-- root/root 8609 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_text.hpp.rst.txt -rw-r--r-- root/root 6319 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_utilities.hpp.rst.txt -rw-r--r-- root/root 13519 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/program_listing_file_cif++_validate.hpp.rst.txt -rw-r--r-- root/root 301 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1atom__type__info.rst.txt -rw-r--r-- root/root 472 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1atom__type__traits_1_1SFData.rst.txt -rw-r--r-- root/root 444 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1category_1_1item__entry.rst.txt -rw-r--r-- root/root 469 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1category_1_1key__element__type.rst.txt -rw-r--r-- root/root 419 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1category_1_1link.rst.txt -rw-r--r-- root/root 315 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1category__validator.rst.txt -rw-r--r-- root/root 349 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1colour_1_1detail_1_1coloured__string__t.rst.txt -rw-r--r-- root/root 295 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1compound__atom.rst.txt -rw-r--r-- root/root 295 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1compound__bond.rst.txt -rw-r--r-- root/root 284 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1empty__type.rst.txt -rw-r--r-- root/root 301 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1ff__charconv.rst.txt -rw-r--r-- root/root 258 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1iless.rst.txt -rw-r--r-- root/root 283 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1item__alias.rst.txt -rw-r--r-- root/root 283 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1item__handle.rst.txt -rw-r--r-- root/root 299 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1item__validator.rst.txt -rw-r--r-- root/root 279 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1item__value.rst.txt -rw-r--r-- root/root 255 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1key.rst.txt -rw-r--r-- root/root 299 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1link__validator.rst.txt -rw-r--r-- root/root 339 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1mm_1_1structure__open__options.rst.txt -rw-r--r-- root/root 298 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1point__type.rst.txt -rw-r--r-- root/root 287 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1space__group.rst.txt -rw-r--r-- root/root 267 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1sym__op.rst.txt -rw-r--r-- root/root 283 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1symop__data.rst.txt -rw-r--r-- root/root 303 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1symop__datablock.rst.txt -rw-r--r-- root/root 299 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/structcif_1_1type__validator.rst.txt -rw-r--r-- root/root 269 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/typedef_gzio_8hpp_1a41d20db90846830c07aa1b4052e4d61f.rst.txt -rw-r--r-- root/root 272 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/typedef_gzio_8hpp_1a584b8865c9038c4eeba40de7d4a9f1aa.rst.txt -rw-r--r-- root/root 272 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/typedef_gzio_8hpp_1a878fb88f8eb9b8c5bde4ed2616dca237.rst.txt -rw-r--r-- root/root 257 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/typedef_namespacecif_1a0d929afa021a00eaa3819005173553b4.rst.txt -rw-r--r-- root/root 290 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/typedef_namespacecif_1a2551a5f548db36f37a54c902a7159580.rst.txt -rw-r--r-- root/root 262 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/typedef_namespacecif_1a35974aa02359ef095b68335a05849c53.rst.txt -rw-r--r-- root/root 249 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/typedef_namespacecif_1a5ae3b948c3296e47bf3ae734cfdca029.rst.txt -rw-r--r-- root/root 262 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/typedef_namespacecif_1a74bfe90596358d194adfab0eb0054b79.rst.txt -rw-r--r-- root/root 264 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/typedef_namespacecif_1a88b677fc53a3f1e8e0f15cdb6dc52cb7.rst.txt -rw-r--r-- root/root 292 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/typedef_namespacecif_1a8dcfa853b7f2c8b6dcc921d0c646ab46.rst.txt -rw-r--r-- root/root 292 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/typedef_namespacecif_1aaca06426423d3d411d330b53965e1b2d.rst.txt -rw-r--r-- root/root 245 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/typedef_namespacecif_1ae5965db5577f7f70118a5d976232d966.rst.txt -rw-r--r-- root/root 1945 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/unabridged_orphan.rst.txt -rw-r--r-- root/root 308 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/variable_gzio_8hpp_1a1cc3c9e961807f24cc997b0fdfbe76a6.rst.txt -rw-r--r-- root/root 279 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1a1c4c3a9495336c603c5f3d7f77f4dc64.rst.txt -rw-r--r-- root/root 284 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1a1c875e7bda01246ff90860b7228b89b9.rst.txt -rw-r--r-- root/root 277 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1a2ac4506e2b83a34ec6cc15a024f9b677.rst.txt -rw-r--r-- root/root 291 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1a335e9db77e4d400afe98317a0da325f9.rst.txt -rw-r--r-- root/root 249 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1a481dab6db30774c8562d83bb5182cc7b.rst.txt -rw-r--r-- root/root 265 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1a4d1e6f19e4404091efa6d14e14654e63.rst.txt -rw-r--r-- root/root 253 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1a54a676462364096110c8178e02693802.rst.txt -rw-r--r-- root/root 256 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1a6dacacf91cee6e2c246a2334f0fbd607.rst.txt -rw-r--r-- root/root 253 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1a9347107ebb4ef72dca122c3285453c4f.rst.txt -rw-r--r-- root/root 294 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1a9ebb6f223c638daee2bc1bf285be72c8.rst.txt -rw-r--r-- root/root 292 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1ac0cd49271cfb2fd68933871ab34217d6.rst.txt -rw-r--r-- root/root 282 2025-11-20 08:25 ./usr/share/doc/libcifpp/_sources/api/variable_namespacecif_1aee0d4f8adeaf464b4201156efbb97f73.rst.txt -rw-r--r-- root/root 14011 2025-11-05 12:18 ./usr/share/doc/libcifpp/_sources/basics.rst.txt -rw-r--r-- root/root 2389 2025-11-05 12:18 ./usr/share/doc/libcifpp/_sources/bitsandpieces.rst.txt -rw-r--r-- root/root 3084 2025-11-05 12:18 ./usr/share/doc/libcifpp/_sources/compound.rst.txt -rw-r--r-- root/root 12 2025-11-05 12:18 ./usr/share/doc/libcifpp/_sources/genindex.rst.txt -rw-r--r-- root/root 2425 2025-11-05 12:18 ./usr/share/doc/libcifpp/_sources/index.rst.txt -rw-r--r-- root/root 2167 2025-11-05 12:18 ./usr/share/doc/libcifpp/_sources/model.rst.txt -rw-r--r-- root/root 2020 2025-11-05 12:18 ./usr/share/doc/libcifpp/_sources/resources.rst.txt -rw-r--r-- root/root 6765 2025-11-05 12:18 ./usr/share/doc/libcifpp/_sources/symmetry.rst.txt drwxr-xr-x root/root 0 2025-11-20 08:25 ./usr/share/doc/libcifpp/_static/ -rw-r--r-- root/root 4289 2025-11-20 08:25 ./usr/share/doc/libcifpp/_static/_sphinx_javascript_frameworks_compat.js -rw-r--r-- root/root 14685 2025-11-20 08:25 ./usr/share/doc/libcifpp/_static/basic.css drwxr-xr-x root/root 0 2025-11-20 08:25 ./usr/share/doc/libcifpp/_static/css/ -rw-r--r-- root/root 3404 2025-05-17 20:38 ./usr/share/doc/libcifpp/_static/css/badge_only.css -rw-r--r-- root/root 140442 2025-05-17 20:38 ./usr/share/doc/libcifpp/_static/css/theme.css -rw-r--r-- root/root 4322 2025-11-15 12:07 ./usr/share/doc/libcifpp/_static/doctools.js -rw-r--r-- root/root 328 2025-11-20 08:25 ./usr/share/doc/libcifpp/_static/documentation_options.js -rw-r--r-- root/root 286 2025-11-15 12:07 ./usr/share/doc/libcifpp/_static/file.png drwxr-xr-x root/root 0 2025-11-20 08:25 ./usr/share/doc/libcifpp/_static/fonts/ -rw-r--r-- root/root 336887 2015-08-06 16:41 ./usr/share/doc/libcifpp/_static/fonts/Lato-Bold.ttf.gz -rw-r--r-- root/root 211324 2025-05-17 20:38 ./usr/share/doc/libcifpp/_static/fonts/Lato-Bold.woff2 -rw-r--r-- root/root 359903 2015-08-06 16:41 ./usr/share/doc/libcifpp/_static/fonts/Lato-BoldItalic.ttf.gz -rw-r--r-- root/root 228252 2025-05-17 20:38 ./usr/share/doc/libcifpp/_static/fonts/Lato-BoldItalic.woff2 -rw-r--r-- root/root 366868 2015-08-06 16:41 ./usr/share/doc/libcifpp/_static/fonts/Lato-Italic.ttf.gz -rw-r--r-- root/root 231456 2025-05-17 20:38 ./usr/share/doc/libcifpp/_static/fonts/Lato-Italic.woff2 -rw-r--r-- root/root 337725 2015-08-06 16:41 ./usr/share/doc/libcifpp/_static/fonts/Lato-Regular.ttf.gz -rw-r--r-- root/root 211556 2025-05-17 20:38 ./usr/share/doc/libcifpp/_static/fonts/Lato-Regular.woff2 -rw-r--r-- root/root 52828 2025-05-17 20:38 ./usr/share/doc/libcifpp/_static/fonts/RobotoSlab-Bold.woff2 -rw-r--r-- root/root 52532 2025-05-17 20:38 ./usr/share/doc/libcifpp/_static/fonts/RobotoSlab-Regular.woff2 -rw-r--r-- root/root 98417 2016-10-24 15:52 ./usr/share/doc/libcifpp/_static/fonts/fontawesome-webfont.eot.gz -rw-r--r-- root/root 444379 2016-10-24 15:52 ./usr/share/doc/libcifpp/_static/fonts/fontawesome-webfont.svg -rw-r--r-- root/root 98328 2016-10-24 15:52 ./usr/share/doc/libcifpp/_static/fonts/fontawesome-webfont.ttf.gz -rw-r--r-- root/root 98024 2016-10-24 15:52 ./usr/share/doc/libcifpp/_static/fonts/fontawesome-webfont.woff -rw-r--r-- root/root 77160 2016-10-24 15:52 ./usr/share/doc/libcifpp/_static/fonts/fontawesome-webfont.woff2 -rw-r--r-- root/root 86512 2025-11-20 08:25 ./usr/share/doc/libcifpp/_static/jquery.js drwxr-xr-x root/root 0 2025-11-20 08:25 ./usr/share/doc/libcifpp/_static/js/ -rw-r--r-- root/root 9480 2025-05-17 20:38 ./usr/share/doc/libcifpp/_static/js/theme.js -rw-r--r-- root/root 6978 2025-11-20 08:25 ./usr/share/doc/libcifpp/_static/js/versions.js -rw-r--r-- root/root 4598 2025-11-20 08:25 ./usr/share/doc/libcifpp/_static/language_data.js -rw-r--r-- root/root 90 2025-11-15 12:07 ./usr/share/doc/libcifpp/_static/minus.png -rw-r--r-- root/root 90 2025-11-15 12:07 ./usr/share/doc/libcifpp/_static/plus.png -rw-r--r-- root/root 4902 2025-11-20 08:25 ./usr/share/doc/libcifpp/_static/pygments.css -rw-r--r-- root/root 21782 2025-11-15 12:07 ./usr/share/doc/libcifpp/_static/searchtools.js -rw-r--r-- root/root 5123 2025-11-15 12:07 ./usr/share/doc/libcifpp/_static/sphinx_highlight.js drwxr-xr-x root/root 0 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/ -rw-r--r-- root/root 44028 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1atom__type__traits.html -rw-r--r-- root/root 255336 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1category.html -rw-r--r-- root/root 30105 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1cell.html -rw-r--r-- root/root 37047 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1compound.html -rw-r--r-- root/root 47706 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1compound__factory.html -rw-r--r-- root/root 22079 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1compound__source.html -rw-r--r-- root/root 40534 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1condition.html -rw-r--r-- root/root 28803 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1conditional__iterator__proxy.html -rw-r--r-- root/root 29937 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1crystal.html -rw-r--r-- root/root 51970 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1datablock.html -rw-r--r-- root/root 21245 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1duplicate__key__error.html -rw-r--r-- root/root 46809 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1file.html -rw-r--r-- root/root 24894 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1fill__out__streambuf.html -rw-r--r-- root/root 43089 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1gzio_1_1basic__ifstream.html -rw-r--r-- root/root 26952 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1gzio_1_1basic__igzip__streambuf.html -rw-r--r-- root/root 30426 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1gzio_1_1basic__istream.html -rw-r--r-- root/root 43608 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1gzio_1_1basic__ofstream.html -rw-r--r-- root/root 27839 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1gzio_1_1basic__ogzip__streambuf.html -rw-r--r-- root/root 28553 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1gzio_1_1basic__ostream.html -rw-r--r-- root/root 25378 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1gzio_1_1basic__streambuf.html -rw-r--r-- root/root 27622 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1identity__matrix.html -rw-r--r-- root/root 60084 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1item.html -rw-r--r-- root/root 21257 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1iterator__impl.html -rw-r--r-- root/root 20191 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1iterator__impl_3_01Category_00_01T_01_4.html -rw-r--r-- root/root 19586 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1iterator__impl_3_01Category_01_4.html -rw-r--r-- root/root 27460 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1iterator__proxy.html -rw-r--r-- root/root 32111 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1matrix.html -rw-r--r-- root/root 26160 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1matrix__cofactors.html -rw-r--r-- root/root 35645 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1matrix__expression.html -rw-r--r-- root/root 38437 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1matrix__fixed.html -rw-r--r-- root/root 27911 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1matrix__matrix__multiplication.html -rw-r--r-- root/root 29034 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1matrix__scalar__multiplication.html -rw-r--r-- root/root 27368 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1matrix__subtraction.html -rw-r--r-- root/root 22646 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1missing__key__error.html -rw-r--r-- root/root 80889 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1mm_1_1atom.html -rw-r--r-- root/root 37627 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1mm_1_1branch.html -rw-r--r-- root/root 59333 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1mm_1_1monomer.html -rw-r--r-- root/root 28746 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1mm_1_1polymer.html -rw-r--r-- root/root 60256 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1mm_1_1residue.html -rw-r--r-- root/root 112775 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1mm_1_1structure.html -rw-r--r-- root/root 28419 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1mm_1_1sugar.html -rw-r--r-- root/root 20684 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1multiple__results__error.html -rw-r--r-- root/root 20854 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1parse__error.html -rw-r--r-- root/root 23598 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1parser.html -rw-r--r-- root/root 28594 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1progress__bar.html -rw-r--r-- root/root 83334 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1quaternion__type.html -rw-r--r-- root/root 23098 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1row.html -rw-r--r-- root/root 48249 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1row__handle.html -rw-r--r-- root/root 32183 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1row__initializer.html -rw-r--r-- root/root 37927 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1sac__parser.html -rw-r--r-- root/root 31001 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1spacegroup.html -rw-r--r-- root/root 32627 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1spherical__dots.html -rw-r--r-- root/root 25908 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1sub__matrix.html -rw-r--r-- root/root 29962 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1symmetric__matrix.html -rw-r--r-- root/root 30701 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1symmetric__matrix__fixed.html -rw-r--r-- root/root 28683 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1transformation.html -rw-r--r-- root/root 24525 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1validation__category__impl.html -rw-r--r-- root/root 28537 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1validation__exception.html -rw-r--r-- root/root 52090 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1validator.html -rw-r--r-- root/root 26513 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/classcif_1_1validator__factory.html -rw-r--r-- root/root 8613 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/define_exports_8hpp_1a34c1ecdfe0e74030d387cc4e3db0f20d.html -rw-r--r-- root/root 8535 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/define_exports_8hpp_1a42700069adcc34faeda32076bd173dc1.html -rw-r--r-- root/root 8531 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/define_exports_8hpp_1aab9ff10a498bf7bb72ce703e00c6551c.html -rw-r--r-- root/root 8597 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/define_exports_8hpp_1af93831e3c71f1f7a80712cd6b3812992.html -rw-r--r-- root/root 8545 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/define_utilities_8hpp_1abd165ee6474b5b75bf075842fff13a04.html -rw-r--r-- root/root 8545 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/define_utilities_8hpp_1ae2fe1725bb5e9823d089c46b9ed5266e.html -rw-r--r-- root/root 8754 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/dir_cif++.html -rw-r--r-- root/root 5623 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/dir_cif++_pdb.html -rw-r--r-- root/root 13189 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/enum_model_8hpp_1a6085af7e2c3294d3d5520e387757e8dd.html -rw-r--r-- root/root 13187 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/enum_model_8hpp_1a84341c70c74ab432b534a3bac3034dbb.html -rw-r--r-- root/root 12675 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/enum_namespacecif_1a22f8e0bb538e176ebddfe89c7ef03a6d.html -rw-r--r-- root/root 11806 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/enum_namespacecif_1a339253d4b856d267db110e2e55b6fa46.html -rw-r--r-- root/root 14721 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/enum_namespacecif_1a636b6271c6af17a0d73dbe4557061c03.html -rw-r--r-- root/root 82321 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/enum_namespacecif_1a701ee5c69b8bf4a14c0807d32581e87d.html -rw-r--r-- root/root 11490 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/enum_namespacecif_1a9579bd6dc036aa07dcb73e9724cd4f54.html -rw-r--r-- root/root 15849 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/enum_namespacecif_1abd4c1fac9978e10628b9317d386d9287.html -rw-r--r-- root/root 19955 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/enum_namespacecif_1ae5e65dddeeceb84cd55b772eaca216c7.html -rw-r--r-- root/root 11788 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/enum_namespacecif_1aeffd144259eee54425fd70df1a4c119a.html -rw-r--r-- root/root 15565 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/enum_utilities_8hpp_1a2dfb81ba6ea862bc2483f1fed3477dcf.html -rw-r--r-- root/root 13030 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/enum_utilities_8hpp_1a8fd997c36131df71885f44abf2297523.html -rw-r--r-- root/root 7592 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++.hpp.html -rw-r--r-- root/root 9512 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_atom_type.hpp.html -rw-r--r-- root/root 9895 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_category.hpp.html -rw-r--r-- root/root 11324 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_compound.hpp.html -rw-r--r-- root/root 19023 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_condition.hpp.html -rw-r--r-- root/root 7844 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_datablock.hpp.html -rw-r--r-- root/root 6455 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_dictionary_parser.hpp.html -rw-r--r-- root/root 7455 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_exports.hpp.html -rw-r--r-- root/root 7832 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_file.hpp.html -rw-r--r-- root/root 6906 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_format.hpp.html -rw-r--r-- root/root 6784 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_forward_decl.hpp.html -rw-r--r-- root/root 10558 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_gzio.hpp.html -rw-r--r-- root/root 8863 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_item.hpp.html -rw-r--r-- root/root 7998 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_iterator.hpp.html -rw-r--r-- root/root 12967 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_matrix.hpp.html -rw-r--r-- root/root 11081 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_model.hpp.html -rw-r--r-- root/root 7332 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_parser.hpp.html -rw-r--r-- root/root 11988 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_pdb.hpp.html -rw-r--r-- root/root 5506 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_pdb_cif2pdb.hpp.html -rw-r--r-- root/root 5446 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_pdb_io.hpp.html -rw-r--r-- root/root 5506 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_pdb_pdb2cif.hpp.html -rw-r--r-- root/root 5430 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_pdb_tls.hpp.html -rw-r--r-- root/root 14819 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_point.hpp.html -rw-r--r-- root/root 10526 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_row.hpp.html -rw-r--r-- root/root 12563 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_symmetry.hpp.html -rw-r--r-- root/root 16172 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_text.hpp.html -rw-r--r-- root/root 11842 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_utilities.hpp.html -rw-r--r-- root/root 11822 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/file_cif++_validate.hpp.html -rw-r--r-- root/root 32899 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_condition_8hpp_1ae3fb5e492867225091edeba773f91d39.html -rw-r--r-- root/root 32317 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_model_8hpp_1a9bb5822efb054c2979a666d9bfc0913d.html -rw-r--r-- root/root 32519 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_model_8hpp_1aaaea875b497445410924763ba322f0f4.html -rw-r--r-- root/root 31942 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_model_8hpp_1ab82fb33002132ca78f0f0de0855a9883.html -rw-r--r-- root/root 32823 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a00df2cb74b5f9590f7f3e4d64ed08077.html -rw-r--r-- root/root 32058 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a016b23e15d2a1d5f8121a697d7bec68e.html -rw-r--r-- root/root 32733 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a02741e5ba23265cacfda366089d13f00.html -rw-r--r-- root/root 32690 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a04692e2c6a26c3dd823891c93aa68c46.html -rw-r--r-- root/root 33593 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a07568e2424a8b9f3d87c0e7b506f01c8.html -rw-r--r-- root/root 32083 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a07b180b747ac558694dfb1e73503dc71.html -rw-r--r-- root/root 34199 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a0987fe676d4bf9554de808bfe9b13a6b.html -rw-r--r-- root/root 31928 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a0cf4d792e3cf8fb29aa18b8c585b1426.html -rw-r--r-- root/root 31963 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a0e173ffb184bab07d483866b6f2f7274.html -rw-r--r-- root/root 33224 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a0f6dd8dc18df398b116c0c2343c2cfee.html -rw-r--r-- root/root 34898 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a1020ee51b50043210b5e9c8eaecd4c28.html -rw-r--r-- root/root 31734 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a10ff1c475902516ebcd1cf4059ac513b.html -rw-r--r-- root/root 32209 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a1425b605f99bf04eeb638f55c0d91566.html -rw-r--r-- root/root 31889 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a15ce5665ae421c0a3db9fac68c149836.html -rw-r--r-- root/root 31777 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a17188febf04153361cad42eb042da64a.html -rw-r--r-- root/root 32527 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a18461202bb0b0d4d134bc3eb46455776.html -rw-r--r-- root/root 33545 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a1bf743b12f5bba28eab81d100fa6be6f.html -rw-r--r-- root/root 31453 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a1cb6fb0735b49d0e7796d223763718e4.html -rw-r--r-- root/root 31938 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a2190ac2315339dabb5be80f2a8634e29.html -rw-r--r-- root/root 32545 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a23c62f901e53b06d736b955cbb079336.html -rw-r--r-- root/root 32272 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a26cac7b3c044dff1bdcac52425e775f9.html -rw-r--r-- root/root 33713 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a27048ca516d6ab9d61b330b3ae27b37f.html -rw-r--r-- root/root 31505 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a277d04e4939dd9a5167dc90c21c00266.html -rw-r--r-- root/root 32311 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a28d3d6db55465d265cb5b6a7a7d93a6b.html -rw-r--r-- root/root 33259 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a2996a300e6f91f05abb11706b3c3cef2.html -rw-r--r-- root/root 34449 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a2a94aaedfb605f4e6a403e8790ee4cfd.html -rw-r--r-- root/root 31912 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a2b6f06460cea1b44770b316c8c5d4b06.html -rw-r--r-- root/root 33912 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a2bce0a62772ef8e6c5128b36d4cbb9ce.html -rw-r--r-- root/root 32007 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a2db5caf5ac5cd4376f29255fa9eebbc0.html -rw-r--r-- root/root 31502 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a2e9af2d268ca7932d3b5df430dfabfe7.html -rw-r--r-- root/root 33425 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a302fdd5a6fea6ea6a874f4e635bd43e3.html -rw-r--r-- root/root 31314 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a31bf31f1feff330b402ab96d51b4f458.html -rw-r--r-- root/root 32127 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a337647d2ca82951e159b244e0a892f0e.html -rw-r--r-- root/root 31296 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a39ae1da888a5c8a6ee7f1438b78b7734.html -rw-r--r-- root/root 32825 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a3f5264d06e1b2326aadfae8b3b114414.html -rw-r--r-- root/root 31852 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a3fa150213a7a95d9d013b5faeae2d5f2.html -rw-r--r-- root/root 36791 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a444f4493c315230d1137f13d0e28920c.html -rw-r--r-- root/root 34738 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a449c5d43d72a9779d3338c2882d13e36.html -rw-r--r-- root/root 34144 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a470ad3905a4aa5fe52da998640740ab7.html -rw-r--r-- root/root 32450 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a490147eab255051c58bc3d7d16471e17.html -rw-r--r-- root/root 32486 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a4c27e27d4cb70a2e13cf2efb05ccd325.html -rw-r--r-- root/root 32239 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a4c9bbe02598ccb179023f7d9ed18f4e9.html -rw-r--r-- root/root 32673 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a4da118af7b65801fd61c48356e67e4a1.html -rw-r--r-- root/root 32565 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a4f2dd5c988ef77316bb4fdda57146fd5.html -rw-r--r-- root/root 31920 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a52c1d908e7a659686a16cbde3684f7a1.html -rw-r--r-- root/root 32851 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a561da00d019d125f7356b8717771b6b6.html -rw-r--r-- root/root 31695 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a57a7530364c9dfa84f8607824e6d70e3.html -rw-r--r-- root/root 32292 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a5a94d01c3d87fb157ae322b347129e56.html -rw-r--r-- root/root 32476 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a5c256bdffd9190e69c087e64b69d786d.html -rw-r--r-- root/root 32354 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a643804a021f65a34aa75f121f3023104.html -rw-r--r-- root/root 32315 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a65ac1856b4a8a6675e6a0f0d9b5edfaa.html -rw-r--r-- root/root 31950 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a674345a2d0fb9af13bea9c833076cec0.html -rw-r--r-- root/root 31614 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a7555a1d6c76bc1cef206fab9a8d67fad.html -rw-r--r-- root/root 32701 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a75df878566a514b909141bad937280f4.html -rw-r--r-- root/root 32230 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a7b0b6dec945a1157aa9d455fd35494df.html -rw-r--r-- root/root 32817 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a7da448991e41eef2fa6dbf113827f958.html -rw-r--r-- root/root 32489 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a867dc9c21324a3e65a931bb4d7160a9e.html -rw-r--r-- root/root 32548 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a86caa43dc2def46857ab3eb037b63f2b.html -rw-r--r-- root/root 32363 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a8864838e9763e207066cdbb217920f21.html -rw-r--r-- root/root 32777 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a89f948a7392e875f87012ca961060cb3.html -rw-r--r-- root/root 32157 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a8c224d1a874aab66b434422f03ed85d4.html -rw-r--r-- root/root 33519 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a8c495f22c9ff90161b1ae539552e02aa.html -rw-r--r-- root/root 32498 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a8c894208d05a89ca79ed66421d241f0f.html -rw-r--r-- root/root 31602 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a8f9736ac0d35666ef1a68f02705b8507.html -rw-r--r-- root/root 31656 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a94db0d39a3d82bde5ae35a2d5a729dce.html -rw-r--r-- root/root 31394 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a96cecd643b7fedefcee808419ac8db73.html -rw-r--r-- root/root 32953 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a9a07496ad027d7f53edeba05b8946d15.html -rw-r--r-- root/root 32423 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a9a46e6bb8184b5c4b2867e50d4bafd46.html -rw-r--r-- root/root 32092 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a9dbdac69f3a21d391ece6cc214da3075.html -rw-r--r-- root/root 32308 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a9de541062d328307198b32e4680ac29b.html -rw-r--r-- root/root 31491 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1a9ef12a84362871f9b37c36d526dcdc87.html -rw-r--r-- root/root 32456 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1aa0722da1df2e70c4c68cb1e512978cae.html -rw-r--r-- root/root 32683 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1aa629e0bd1ddd07f3ffd7bde1bf0bf0fb.html -rw-r--r-- root/root 33273 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1aa697ec53ac311721d137e96508fe6268.html -rw-r--r-- root/root 35700 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1aa6ba3ba2b2b2dcbabee10461e0b8cad3.html -rw-r--r-- root/root 32049 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1aae2f02104c912443c2f40b2647803ccb.html -rw-r--r-- root/root 32348 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1aaede7d3ae547f8c18450a83b6bcc42e2.html -rw-r--r-- root/root 32560 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1ab173f10abbd57122dbfd669f30af5509.html -rw-r--r-- root/root 32732 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1ab4b982e1dc64e54d408cf8a9a99a2851.html -rw-r--r-- root/root 31819 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1ab5bf28cddf2fe7bbfe60778c60f9082e.html -rw-r--r-- root/root 32854 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1ab80f7d084a897f8654fecdcbe4c598ba.html -rw-r--r-- root/root 32559 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1ab91dfb39e9ee43942c5d384f161b97f3.html -rw-r--r-- root/root 35574 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1ab97c8f7af37ad32ee1e96218eef8e0e1.html -rw-r--r-- root/root 33622 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1ab9c1b63f260c9ccc3740971d6ca755c7.html -rw-r--r-- root/root 31913 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1abbc95fb717f14cca92d73ff5ed83c685.html -rw-r--r-- root/root 32094 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1abce4bb85397326d1c0a079f43048fa18.html -rw-r--r-- root/root 31685 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1ac0219abe114a15fecf35b9305c6a51b9.html -rw-r--r-- root/root 32384 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1ac0f43cdcc8b1ba95aae5fa92f623993d.html -rw-r--r-- root/root 32420 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1ac29c380eff41208bca6fce85b26cbb0b.html -rw-r--r-- root/root 32036 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1ac3d9a984c107208b0abbabe5f9e05289.html -rw-r--r-- root/root 31407 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1ac4c468df4c799fd242842a86e523bc3e.html -rw-r--r-- root/root 31473 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1acb24b83a370551b91948baf851bc3ba4.html -rw-r--r-- root/root 32852 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1acc0e956a0d6382e85c6ecb631e2edd21.html -rw-r--r-- root/root 31691 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1acde0f42396a36ed1d56f59e8754968b9.html -rw-r--r-- root/root 33408 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1ad0c5beb6c8ad7621c2ec415432b33c48.html -rw-r--r-- root/root 32440 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1ad3654e07e2f3102ac503499fa51d930f.html -rw-r--r-- root/root 32008 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1ad57ceedd9a74df6a781247532781c5fa.html -rw-r--r-- root/root 34436 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1ad6daf4b6c782edbfeb0236e71f9e6ae1.html -rw-r--r-- root/root 32668 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1ad8a62060b4918e8fcdba571adcde4295.html -rw-r--r-- root/root 32471 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1adecaf77ddb0b38da346fecf70b5df2e0.html -rw-r--r-- root/root 33065 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1ae025ebbaf906da6b0e66d3fa6657c536.html -rw-r--r-- root/root 31951 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1ae338b65793c18872e8bcdfe6a534c83b.html -rw-r--r-- root/root 31879 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1ae8f1330ded658c851bda5859f2e071bc.html -rw-r--r-- root/root 35194 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1aeb2069c34c7d86acc4418d3740adf5d8.html -rw-r--r-- root/root 32705 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1aeb28b4b173153589179f4f7b5d20c063.html -rw-r--r-- root/root 32472 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1aee7c4c79e259a8c70f8534f1ce3e39a5.html -rw-r--r-- root/root 31530 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1af443771f125de0bdc78726a4235fc1a3.html -rw-r--r-- root/root 31996 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1af6e09fd9a34540b7718e7f76a0029629.html -rw-r--r-- root/root 32407 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_namespacecif_1afdee9d0ba328b6dc1219e83b128b003b.html -rw-r--r-- root/root 33049 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_pdb_8hpp_1a022f50570f0370ddce514869b65fb6ae.html -rw-r--r-- root/root 32854 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_pdb_8hpp_1a0ca52e86fd5c866cb07ee1d2bd6e0be6.html -rw-r--r-- root/root 32995 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_pdb_8hpp_1a0cdfe208e415aa2b34e1277e5de112cb.html -rw-r--r-- root/root 31898 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_pdb_8hpp_1a0d8dcb296d80df362a6d47d62b9e01c9.html -rw-r--r-- root/root 32499 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_pdb_8hpp_1a2bcb3bdc779f63c96a1eb84e45ff4c20.html -rw-r--r-- root/root 34580 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_pdb_8hpp_1a346afa86961c301f1d4fa6486584e7c7.html -rw-r--r-- root/root 33645 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_pdb_8hpp_1a3beb1e1704887c34c3ffcf62ba4c93a2.html -rw-r--r-- root/root 33051 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_pdb_8hpp_1a429736e305a06f11b86700d76f8b1ac3.html -rw-r--r-- root/root 31888 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_pdb_8hpp_1a5f015134e46f13c6ef9eb9ed84b66d1a.html -rw-r--r-- root/root 32318 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_pdb_8hpp_1a631597613cf60653370f704184d3b9d7.html -rw-r--r-- root/root 33079 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_pdb_8hpp_1a8442a8beb3ec3862b1223091ba279b3f.html -rw-r--r-- root/root 32877 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_pdb_8hpp_1a965679d61a80ce38487bb63eb1759281.html -rw-r--r-- root/root 34178 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_pdb_8hpp_1aa0d4c3ad5c58499e9cf38a4dd42d11d1.html -rw-r--r-- root/root 32390 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_pdb_8hpp_1aa1addf5082e01849dc7b0af93aa0d34d.html -rw-r--r-- root/root 32995 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_pdb_8hpp_1aa57fd6d1c296ee70c9784fc59382d7c1.html -rw-r--r-- root/root 32769 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_pdb_8hpp_1aae0b184e743aa515b75da7b3c494b8ee.html -rw-r--r-- root/root 32430 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_pdb_8hpp_1ac681cb3a6237bc71dcba0e88fb1c0832.html -rw-r--r-- root/root 32203 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_pdb_8hpp_1affa360f702ea4f0811f02b87211294c0.html -rw-r--r-- root/root 32880 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/function_symmetry_8hpp_1a5a53cac9d72c839c804fd7619f764d67.html -rw-r--r-- root/root 523011 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/library_root.html -rw-r--r-- root/root 57558 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/namespace_cif.html -rw-r--r-- root/root 8514 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/namespace_cif__colour.html -rw-r--r-- root/root 7996 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/namespace_cif__colour__detail.html -rw-r--r-- root/root 7593 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/namespace_cif__detail.html -rw-r--r-- root/root 10489 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/namespace_cif__gzio.html -rw-r--r-- root/root 8238 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/namespace_cif__literals.html -rw-r--r-- root/root 10596 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/namespace_cif__mm.html -rw-r--r-- root/root 12486 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/namespace_cif__pdb.html -rw-r--r-- root/root 6294 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/page_deprecated.html -rw-r--r-- root/root 8143 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++.hpp.html -rw-r--r-- root/root 43090 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_atom_type.hpp.html -rw-r--r-- root/root 161992 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_category.hpp.html -rw-r--r-- root/root 40872 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_compound.hpp.html -rw-r--r-- root/root 200859 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_condition.hpp.html -rw-r--r-- root/root 23002 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_datablock.hpp.html -rw-r--r-- root/root 7965 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_dictionary_parser.hpp.html -rw-r--r-- root/root 7047 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_exports.hpp.html -rw-r--r-- root/root 22067 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_file.hpp.html -rw-r--r-- root/root 18360 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_format.hpp.html -rw-r--r-- root/root 8405 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_forward_decl.hpp.html -rw-r--r-- root/root 152310 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_gzio.hpp.html -rw-r--r-- root/root 121243 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_item.hpp.html -rw-r--r-- root/root 131163 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_iterator.hpp.html -rw-r--r-- root/root 145976 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_matrix.hpp.html -rw-r--r-- root/root 173004 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_model.hpp.html -rw-r--r-- root/root 52811 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_parser.hpp.html -rw-r--r-- root/root 18165 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_pdb.hpp.html -rw-r--r-- root/root 7225 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_pdb_cif2pdb.hpp.html -rw-r--r-- root/root 7175 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_pdb_io.hpp.html -rw-r--r-- root/root 7225 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_pdb_pdb2cif.hpp.html -rw-r--r-- root/root 7162 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_pdb_tls.hpp.html -rw-r--r-- root/root 190270 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_point.hpp.html -rw-r--r-- root/root 59783 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_row.hpp.html -rw-r--r-- root/root 77259 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_symmetry.hpp.html -rw-r--r-- root/root 50207 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_text.hpp.html -rw-r--r-- root/root 29400 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_utilities.hpp.html -rw-r--r-- root/root 65551 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/program_listing_file_cif++_validate.hpp.html -rw-r--r-- root/root 23653 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1atom__type__info.html -rw-r--r-- root/root 18991 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1atom__type__traits_1_1SFData.html -rw-r--r-- root/root 22735 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1category_1_1item__entry.html -rw-r--r-- root/root 21401 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1category_1_1key__element__type.html -rw-r--r-- root/root 22478 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1category_1_1link.html -rw-r--r-- root/root 30770 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1category__validator.html -rw-r--r-- root/root 27539 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1colour_1_1detail_1_1coloured__string__t.html -rw-r--r-- root/root 28105 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1compound__atom.html -rw-r--r-- root/root 22216 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1compound__bond.html -rw-r--r-- root/root 18860 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1empty__type.html -rw-r--r-- root/root 19017 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1ff__charconv.html -rw-r--r-- root/root 20371 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1iless.html -rw-r--r-- root/root 25654 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1item__alias.html -rw-r--r-- root/root 49101 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1item__handle.html -rw-r--r-- root/root 31449 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1item__validator.html -rw-r--r-- root/root 27274 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1item__value.html -rw-r--r-- root/root 25635 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1key.html -rw-r--r-- root/root 24593 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1link__validator.html -rw-r--r-- root/root 26860 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1mm_1_1structure__open__options.html -rw-r--r-- root/root 79719 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1point__type.html -rw-r--r-- root/root 21661 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1space__group.html -rw-r--r-- root/root 27922 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1sym__op.html -rw-r--r-- root/root 26658 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1symop__data.html -rw-r--r-- root/root 23783 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1symop__datablock.html -rw-r--r-- root/root 34176 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/structcif_1_1type__validator.html -rw-r--r-- root/root 10785 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/typedef_gzio_8hpp_1a41d20db90846830c07aa1b4052e4d61f.html -rw-r--r-- root/root 10781 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/typedef_gzio_8hpp_1a584b8865c9038c4eeba40de7d4a9f1aa.html -rw-r--r-- root/root 10811 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/typedef_gzio_8hpp_1a878fb88f8eb9b8c5bde4ed2616dca237.html -rw-r--r-- root/root 12157 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/typedef_namespacecif_1a0d929afa021a00eaa3819005173553b4.html -rw-r--r-- root/root 12501 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/typedef_namespacecif_1a2551a5f548db36f37a54c902a7159580.html -rw-r--r-- root/root 10934 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/typedef_namespacecif_1a35974aa02359ef095b68335a05849c53.html -rw-r--r-- root/root 10203 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/typedef_namespacecif_1a5ae3b948c3296e47bf3ae734cfdca029.html -rw-r--r-- root/root 10936 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/typedef_namespacecif_1a74bfe90596358d194adfab0eb0054b79.html -rw-r--r-- root/root 10291 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/typedef_namespacecif_1a88b677fc53a3f1e8e0f15cdb6dc52cb7.html -rw-r--r-- root/root 10884 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/typedef_namespacecif_1a8dcfa853b7f2c8b6dcc921d0c646ab46.html -rw-r--r-- root/root 11008 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/typedef_namespacecif_1aaca06426423d3d411d330b53965e1b2d.html -rw-r--r-- root/root 10530 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/typedef_namespacecif_1ae5965db5577f7f70118a5d976232d966.html -rw-r--r-- root/root 39668 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/unabridged_orphan.html -rw-r--r-- root/root 10600 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/variable_gzio_8hpp_1a1cc3c9e961807f24cc997b0fdfbe76a6.html -rw-r--r-- root/root 9710 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/variable_namespacecif_1a1c4c3a9495336c603c5f3d7f77f4dc64.html -rw-r--r-- root/root 9763 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/variable_namespacecif_1a1c875e7bda01246ff90860b7228b89b9.html -rw-r--r-- root/root 9877 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/variable_namespacecif_1a2ac4506e2b83a34ec6cc15a024f9b677.html -rw-r--r-- root/root 9680 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/variable_namespacecif_1a335e9db77e4d400afe98317a0da325f9.html -rw-r--r-- root/root 10234 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/variable_namespacecif_1a481dab6db30774c8562d83bb5182cc7b.html -rw-r--r-- root/root 9838 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/variable_namespacecif_1a4d1e6f19e4404091efa6d14e14654e63.html -rw-r--r-- root/root 10708 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/variable_namespacecif_1a54a676462364096110c8178e02693802.html -rw-r--r-- root/root 10937 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/variable_namespacecif_1a6dacacf91cee6e2c246a2334f0fbd607.html -rw-r--r-- root/root 10332 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/variable_namespacecif_1a9347107ebb4ef72dca122c3285453c4f.html -rw-r--r-- root/root 9707 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/variable_namespacecif_1a9ebb6f223c638daee2bc1bf285be72c8.html -rw-r--r-- root/root 11480 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/variable_namespacecif_1ac0cd49271cfb2fd68933871ab34217d6.html -rw-r--r-- root/root 9749 2025-11-20 08:25 ./usr/share/doc/libcifpp/api/variable_namespacecif_1aee0d4f8adeaf464b4201156efbb97f73.html -rw-r--r-- root/root 52577 2025-11-20 08:25 ./usr/share/doc/libcifpp/basics.html -rw-r--r-- root/root 12457 2025-11-20 08:25 ./usr/share/doc/libcifpp/bitsandpieces.html -rw-r--r-- root/root 9635 2025-11-20 08:25 ./usr/share/doc/libcifpp/compound.html -rw-r--r-- root/root 209168 2025-11-20 08:25 ./usr/share/doc/libcifpp/genindex.html -rw-r--r-- root/root 20805 2025-11-20 08:25 ./usr/share/doc/libcifpp/index.html -rw-r--r-- root/root 9320 2025-11-20 08:25 ./usr/share/doc/libcifpp/model.html -rw-r--r-- root/root 79344 2025-11-20 08:25 ./usr/share/doc/libcifpp/objects.inv -rw-r--r-- root/root 8336 2025-11-20 08:25 ./usr/share/doc/libcifpp/resources.html -rw-r--r-- root/root 4537 2025-11-20 08:25 ./usr/share/doc/libcifpp/search.html -rw-r--r-- root/root 571316 2025-11-20 08:25 ./usr/share/doc/libcifpp/searchindex.js -rw-r--r-- root/root 27601 2025-11-20 08:25 ./usr/share/doc/libcifpp/symmetry.html +------------------------------------------------------------------------------+ | Post Build Fri, 21 Nov 2025 16:39:44 +0000 | +------------------------------------------------------------------------------+ +------------------------------------------------------------------------------+ | Cleanup Fri, 21 Nov 2025 16:39:44 +0000 | +------------------------------------------------------------------------------+ Purging /build/reproducible-path Not cleaning session: cloned chroot in use +------------------------------------------------------------------------------+ | Summary Fri, 21 Nov 2025 16:39:45 +0000 | +------------------------------------------------------------------------------+ Build Architecture: amd64 Build Type: all Build-Space: 414600 Build-Time: 91 Distribution: unstable Host Architecture: amd64 Install-Time: 3 Job: /srv/rebuilderd/tmp/rebuilderdlRVcav/inputs/libcifpp_9.0.5-1.dsc Machine Architecture: amd64 Package: libcifpp Package-Time: 104 Source-Version: 9.0.5-1 Space: 414600 Status: successful Version: 9.0.5-1 -------------------------------------------------------------------------------- Finished at 2025-11-21T16:39:41Z Build needed 00:01:44, 414600k disk space build artifacts stored in /srv/rebuilderd/tmp/rebuilderdlRVcav/out checking libcifpp-data_9.0.5-1_all.deb: size... sha1... sha256... md5... all OK checking libcifpp-doc_9.0.5-1_all.deb: size differs for libcifpp-doc_9.0.5-1_all.deb